CAZyme Information: P168DRAFT_239224-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_239224-t37_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		53873.78	4.7171

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000009:950844-952274(+)

Full Sequence      

MGTPIVARKRLLRFLVAICLVSAFSFVLWPHVEQPSVTTTTISGNVTVTSDVQCDPDTDV
LNRLNIRKLSQYVRRDVIAVPSAANDPLPIKHLLNYPLFEPSLPSVDAQGNPLEEPAQKD
CKMDDPITVQVPRPPRNVDASHIDFGVATTLSRLNDSVEQFAHWAGYTRTRIFALIEPDA
RAAEVQAKADLLGINLYITESDEEYQRRYFSLVAHLAQNVRSQTRWSCIIDDDTFFMSMS
TLVKALSEYDDTKNYYVGGLSESIPQIGVFGLMGFGGAGVFLSRPLLLELSDPDVFEACQ
NMDFTGDRRISICVYQNTETHLTINHGLHQLDVTGDVSGFFESGRQPPLSVHHWKSWFHT
DMGKLSVVRDICGDSCLLRQWQFEDGWILTNGYSIIKYSLPVDPFEKTMELTWDGENGAV
YESYLHEFGPMRPKDEQKYSYLLEDAVLEGNQVRQWYVHRDEANGDQVFELTWRAG

Enzyme Prediction     

No EC number prediction in P168DRAFT_239224-t37_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	1.44e-11	222	353	209	341	hypothetical protein; Provisional
367085	Fringe	6.48e-10	164	357	28	231	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	4.55e-07	273	353	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
214400	ND5	0.010	236	291	340	399	NADH dehydrogenase subunit 5; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58287.1|GT31	2.62e-248	1	475	12	484
UDD56605.1|GT31	2.62e-248	1	475	12	484
QMW40633.1|GT31	7.51e-248	1	475	12	484
QRD83076.1|GT31	4.33e-247	1	475	12	484
QMW28562.1|GT31	4.33e-247	1	475	12	484

PDB Hits     

P168DRAFT_239224-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P168DRAFT_239224-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999520	0.000486

TMHMM  Annotations     

Start	End
12	29