CAZyme Information: P168DRAFT_238677-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_238677-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: beta-glucosidase-related glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	MSFM01000008|CGC5	93436.18	5.0259

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000008:545957-548669(+)

Full Sequence      

MVALSLSLALAASLAPWAQASPTTKHLEVRADDKAYSPPYYPAPKGGWLSDWEDAYEKAH
ELVSQMTLAEKVNLTTGTGIFMGRCSGQTGSVSRLGVPQLCINDGPLGVRNTDLATAFPA
GITVGATFDKELMHERGVAMGEESRGKGVNVLLGPSVGPIGRKPRGGRNWEGFGADPVLQ
GIAAAQTIKGMQSTGAIACIKHYIGNEQEMHRMSSVVTQGYSSNIDDRTLHELYLWPFAE
SVRAGVGSLMTAYNDVNRSSCSQNSKLLNDILKDELGFQGFVMTDWLGHYGGVSSALAGL
DMSMPGDGSLPLFGTSYWGSDMSRSVLNGTVPLDRLNDMVTRIVATWYQMGQDKDYPLPN
FSTNTAADKALLYPGAVLSPIGVVNEHVDVQGNHNETARAVARDAITLLKNEGETLPLKK
DDSLYVFGTDAGSDPQGLNSCADKGCNRGVLTMGWGSGTAKLPYLVTPQEAIANISSKAE
FHITDSFPKDVSPGPDDVAVVFISADAGENFIIVDGNPGDRTKADLKAWHKGDELVKDAA
EKFSTVVVVVHTVGPILMEEWIELPSVKAVLVAHLPGQEAGWSLTDVLFGDYSPSGHMPY
TIPRSEDNYPESVSLIQQPFGQIQDDYTERLYIDYRHFMKADVTPRYPFGHGLSYTTFDY
SKPSLSVVTPLDSAYPPARGPKGSTPTYPDTKPAPSEVAWPKDFPRITRYLYPYLDNPEG
AAANSSKKYPYPEGYTTKPKPGPRAGGGAGGNPALWDVAYSVQVTVTNSGKRPGRAVAQL
YVELPTDLGVDTPSRQLRQFEKTKTLAPGESEIVTLEVTRKDVSVWNAIVQDWQVPVNGE
GVNIYVGESVADERVVCKVGDKCSTL

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	91	305	9.1e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.59e-57	93	445	56	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	2.01e-52	31	847	20	751	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	4.02e-43	406	655	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.02e-36	93	343	62	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.28e-28	58	827	52	752	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE57053.1|GH3|3.2.1.21	0.0	1	866	1	866
BCS24028.1|GH3	0.0	6	866	5	866
QMW39401.1|GH3	0.0	1	866	1	866
QMW27330.1|GH3	0.0	1	866	1	866
QRD81707.1|GH3	0.0	1	866	1	866

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	2.57e-239	32	835	1	815	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5JU6_A	3.07e-239	29	849	17	841	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJJ_A	2.41e-237	32	849	2	828	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5NBS_A	1.57e-236	26	849	9	846	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5FJI_A	4.66e-235	35	835	4	818	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y7Q8|BGLF_ASPFC	0.0	2	866	7	869	Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglF PE=3 SV=2
sp|Q0CI67|BGLF_ASPTN	0.0	16	866	15	867	Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglF PE=3 SV=1
sp|B8NP65|BGLF_ASPFN	0.0	1	866	1	866	Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglF PE=3 SV=1
sp|Q2UN12|BGLF_ASPOR	0.0	1	866	1	866	Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglF PE=3 SV=1
sp|Q4WMU3|BGLF_ASPFU	0.0	2	866	7	869	Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000451	0.999520	CS pos: 20-21. Pr: 0.9696

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_238677-t37_1-p1.