CAZyme Information: P168DRAFT_235063-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_235063-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: GDSL-like Lipase/Acylhydrolase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MSFM01000005|CGC2	45023.30	6.2885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000005:1170682-1172573(-)

Full Sequence      

MRIERVLLNWSCLSISVIWAIILQNGQLRLNAYPGQAPLIPHAAGNSLWRHYAPSAPEIS
YQGRWDNQYISSPGLRLEFTGHQLALSFGQHTDPGVLIAYRLGRLDWQFSNVTGNSTYQF
IGPWTPGINGSIASEKKSFELRGESCTVQISGVAVAADGKLSQIQRASKTVEVIGDSLSI
GQYATYEGLSSWAYAVGAGLQDVEYSITAYSGICVHDRECWGNHHGQVYQWYRTCDSSPR
ARRIYGANPPRWDFGAHAAADLVIINLGANDDLNGVSSTDLVSSYITLIDGVHSVWPDAH
IVIMSLWGDFVQRGLTFVQAPQGVREITTVYQHYRDQGKGYVHFFETSGIFKHGDIAQDG
HLNDMGNAKLASHLMQWISSQFGWTMDTDGAEILHGTQYWNTEGNY

Enzyme Prediction     

No EC number prediction in P168DRAFT_235063-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	171	378	5.1e-22	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	1.53e-36	171	378	2	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
404371	Lipase_GDSL_2	3.69e-11	173	369	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	4.34e-08	171	376	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238871	XynB_like	1.10e-04	258	371	39	150	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238879	NnaC_like	0.008	263	378	55	174	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17295.1|CE0	1.03e-146	14	406	10	400
QMW34907.1|CE0	4.43e-135	15	406	6	398
QMW46983.1|CE0	4.43e-135	15	406	6	398
QRD91240.1|CE0	4.43e-135	15	406	6	398
BCS11519.1|CE0	5.85e-120	71	406	40	368

PDB Hits     

P168DRAFT_235063-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P168DRAFT_235063-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.970973	0.029055

TMHMM  Annotations     

Start	End
7	24