CAZyme Information: P168DRAFT_233360-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_233360-t37_1-p1
• CAZy Family: AA4
• CAZyme Description: FAD-linked oxidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		66460.27	5.7570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000004:2159482-2161445(+)

Full Sequence      

MTVPEPFTLALHAAENRLAGETVETWIRTAERIPTTAILPPGLDAATWTDVVAAFCDILG
NDGVLTGHEHRVRYADPYAELQDEGEQEKRGTAATLYPVTVEHIQSILKVCNKHSIPTWT
VSRGKNLGYGGPAARVKGSIILDLQRMTKIIDVNDRYSYYTVEPGVTFFDIYRAIQEKKA
NMWCSCPALGWGSIVGNALDRGWGYTPAGDHSNQICGMEVVLADGTLVRTGMGALEDSVC
WPLFRGGYGPTYESMFSQSNFGIVTKLSIWASPSPEGYMICRLDVEDEADLNPMIEIFRK
LLMHDTIQNHPIIGNIPREMAKKGPRSKFYDGDGAIPDARLKEIQRELGVGFWSARFGLY
GPREMIEFNYKRCQRAFEQLPGAKVSGTAFYPPDGKEYLSPEDLPVEFRTVETGTPSLLA
LKSVQYRGEDGGHVSFSPILPPDGKASLDFYHAAKACCAEYGFEYFGGLHLYDRHLAMIN
MIYFDRQDETDRQNANKAFVDLVHLARKYGYSEYRAHVDYMDLVAEQYDFNGRSLMTLNQ
RIKDAVDPQGILSPGKQGIWPRQYRQEAPKQEPTGVHNALNGLAIQDTNYAQKL

Enzyme Prediction     

No EC number prediction in P168DRAFT_233360-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	38	567	2.9e-166	0.9885057471264368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	9.01e-29	54	557	1	455	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.91e-28	93	231	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
397178	FAD-oxidase_C	4.31e-14	432	556	125	247	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.
178402	PLN02805	1.15e-05	50	291	100	327	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM13434.1|AA4	0.0	6	585	9	584
QGA13141.1|AA4	2.16e-155	34	570	30	569
BCS27721.1|AA4	1.73e-154	34	572	30	571
QRC93649.1|AA4	3.37e-147	33	566	25	560
CAE7177218.1|AA4	6.96e-147	33	565	26	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FXD_A	2.10e-113	36	565	2	522	Crystal structure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXD_B Crystal structure of eugenol oxidase in complex with isoeugenol [Rhodococcus jostii RHA1],5FXE_A Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXE_B Crystal structure of eugenol oxidase in complex with coniferyl alcohol [Rhodococcus jostii RHA1],5FXF_A Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXF_B Crystal structure of eugenol oxidase in complex with benzoate [Rhodococcus jostii RHA1],5FXP_A Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1],5FXP_B Crystal structure of eugenol oxidase in complex with vanillin [Rhodococcus jostii RHA1]
1W1L_A	2.24e-101	39	564	12	553	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum],1W1L_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum]
1W1J_A	6.24e-101	39	564	12	553	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: The505Ser Mutant [Penicillium simplicissimum],1W1J_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: The505Ser Mutant [Penicillium simplicissimum]
1DZN_A	6.24e-101	39	564	12	553	Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1DZN_B Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1E0Y_A	6.24e-101	39	564	12	553	Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1E0Y_B Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	4.52e-100	39	564	12	553	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|P09788|DH4C_PSEPU	3.58e-98	37	559	7	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
sp|P94535|GLCD_BACSU	3.04e-14	94	276	43	218	Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) OX=224308 GN=glcD PE=3 SV=1
sp|F1QXM5|LDHD_DANRE	1.37e-13	51	276	35	248	Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
sp|P9WIT0|Y2280_MYCTO	2.71e-12	49	273	2	213	Uncharacterized FAD-linked oxidoreductase MT2338 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2338 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000020

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_233360-t37_1-p1.