CAZyme Information: P168DRAFT_233190-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_233190-t37_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MSFM01000004|CGC2	43821.24	5.1504

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000004:1857640-1858914(-)

Full Sequence      

MQTRKSVFCRALQILLVTCTLYFFYATVLEKAREASWSDAVSDFVRRSLSDGVFGHIGNR
TLGFEHIYAIGLEERTDKRDFMALTTAVSGITVQWMDGVRPDELHEKSLPQGYNLTLMKP
AAVGCWRAHMNALNDMLSNGYSTALILEDDADWDVTLRAQLQEFAVGLHALKGTRKISKE
APYGVDWDVLWIGGCASGPNSSETDFYAIPNDPTVPRTEHRGTWGGPLEQWKEQYPEYPE
DSTRFVYRSAMGCCTYGYAVSKRGAQNVLMQLSVDHIEGAIDNAMSDLCGFHPNRTRIEC
YAPFPNLVGTYRRAGSAARDSDINVLDWDQVHGEEAWNLIYSTRMNIHRLVAGERTVYSQ
WDEDVPWSDREMNLDEFVYPRGHLVRG

Enzyme Prediction     

No EC number prediction in P168DRAFT_233190-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	64	285	4.5e-33	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	3.57e-21	66	154	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	2.02e-06	63	308	1	207	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
366794	Glyco_transf_25	2.11e-05	64	277	1	199	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP98036.1|GT25	3.30e-174	20	385	17	388
QQK45731.1|GT25	8.47e-174	17	386	14	386
CAP93867.1|GT25	1.52e-164	22	383	25	382
BCS10899.1|GT25	7.10e-156	34	385	31	375
BCR98565.1|GT25	3.05e-155	34	385	73	417

PDB Hits     

P168DRAFT_233190-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5PMF6|GT251_DANRE	2.49e-06	62	193	320	450	Procollagen galactosyltransferase 1 OS=Danio rerio OX=7955 GN=colgalt1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998166	0.001848

TMHMM  Annotations     

Start	End
7	29