CAZyme Information: P168DRAFT_127199-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_127199-t37_1-p1
• CAZy Family: AA1
• CAZyme Description: DUF1237 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		50547.18	6.5793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000004:790160-791591(+)

Full Sequence      

MVDKDLAQLFRNAFPNTLDTTIRWHTDKTPASSKRKREGAQWEGPQTFVVTGDINAEWLR
DSTNQLAGYQSLTKKDKKLHNLILGAINTQAEFVIQSPYCNAFQPPPPSGLKPTDNGQDD
RVHPAYEPSVVFECKYELDSLAHFLALSTEFHENSGSTEFLTGRWYSALQTLLKVLDAQA
KPTFNEQGQFVQNQYTFQRKTDLGTETLNLAGIGNPLSGHTGLIRSAFRPSDDATILGFF
IPPNAMMAVQLKKTAEMIRAAGGKADLARDLQQRGERLDRAVREHGVVQHAKYGDVFAFE
VDGYGSRILMDDANIPSLLALPILGYVDKDDKVYQNTRKMILDKEWNPYYLTGTAFHGIG
GPHIGLQNAWPMSLLVQAMTSDSDEEIKESINLVRNSSLLGLVHESINVNNIKDYSRPWF
AWANSVFAQTILKIAKERPALIFGEGAAPYVPK

Enzyme Prediction     

No EC number prediction in P168DRAFT_127199-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	3	432	4.3e-164	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	3	432	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.22e-157	3	441	24	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD90853.1|GH125	1.77e-283	3	451	86	535
QMW43832.1|GH125	1.77e-283	3	451	86	535
QMW31801.1|GH125	1.77e-283	3	451	86	535
UDD60757.1|GH125	1.77e-283	3	451	86	535
BAE61251.1|GH125	1.45e-282	3	451	86	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	8.53e-97	1	437	67	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	2.12e-96	6	437	52	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	3.94e-94	6	437	50	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	1.63e-79	3	431	25	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	5.69e-79	3	431	25	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.74e-168	3	442	77	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_127199-t37_1-p1.