CAZyme Information: P168DRAFT_117119-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_117119-t37_1-p1
• CAZy Family: AA1
• CAZyme Description: putative alpha-1,6-mannosyltransferase subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MSFM01000003|CGC13	41175.53	4.4718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000003:1511964-1513113(-)

Full Sequence      

MLTPRKALFAALVLIAFVVYLRSSHSTSSVPSSAQVQVPDDAASDHSRDTPGDQTQGQKK
DTLQQPLAPLPSAPLRDRLRYHFPYDLDGKFPAYIWQTWKYTPASLWFGEELRDPEASWT
EMNPDFVHQVVPDDTQYYLIKYLYGSVPEVFEAFESLPLPVLKADFFRYLILLARGGIYS
DIDTTALRPAADWLPEELDLRSISMVIGIEADPDRPDWQEWYSRRIQFCQWTIQAKPGHP
ILRDIVAYITEEALRMKKQGVLKKGKMDKTIVEFTGPAAWTDAVFRFFNDPEYFEIESGS
DNITYEDFTYLEDYRKVGDVVVLPITSFSPGVGQMGAGDIEDPMAFVQHSFDGTWKTDPS
L

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	117	196	3.2e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.63e-39	75	358	66	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.28e-17	118	197	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD84625.1|GT32	5.62e-202	1	361	1	363
UDD58159.1|GT32	1.61e-201	1	361	1	363
CBV36935.1|GT32	7.64e-199	1	361	1	359
CAK39413.1|GT32	8.52e-199	1	361	1	362
BCS07268.1|GT32	5.72e-197	1	361	1	362

PDB Hits     

P168DRAFT_117119-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.40e-91	75	358	83	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.58e-79	76	358	129	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.04e-70	71	361	110	393	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.96e-68	75	358	80	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.730441	0.269568

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_117119-t37_1-p1.