CAZyme Information: OTA39691.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA39691.1
• CAZy Family: GT62
• CAZyme Description: Sterol 3-beta-glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TUV3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1397		155493.96	6.4343

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000002:488096-492289(-)

Full Sequence      

MTSVRRSSASSFRARPGRNSSRSPDRHGMSMQIPARFTVDEEDEEEDVTGRAEPSARSVQ
QSFYGMLGAAGQKQMGRTGFWPDSGSESEGDIELEGGDKAGRASSPGGSRLTKNMPGSDE
EGGSSQRNLIRHSQSKSKTSDTSHLRRKLKPVRERAGSMEGEDQMSQSQFLPPREPQIEA
PERPKSATGIRSDAPMLDRKLKAKAKADLESSTVSSSRNDSERERNQDSVRQRPVDLPSA
LAEIFKFDEAEEIVAEYACWYLQSVLLQGYMYITQKHVCFYAYMPKRGSTVVKSGHLGKQ
GKRNPRYRRYWCQLKGDTLYYFSDAADLYFPRGTIDLRYGISAEMVTEKGHEKSKDSPAF
IITTDSRTYHFRADSVANAREWIKQLQKIIFRSHNDGDSVKISLPLQNVVDVEAIPVIDF
AETIKLRVIDNDETFAMDEYFFTFFEHGRDARAKLNSLTQSNEARKLVSSEEGEEHLDPL
SKGRGLPFSARPSSPGLSEDNDDSGDEEDQPSVEAELAITDNGRRVVRAASHSGSRRHHR
DLQSSISQSAHESGDSFFSASEQTTASPTSPGGAGGIDMSASQMLTGDGAFQAPTLRIPA
SRAGTAEQVGHEPSHASAGQTPTERTTRFPPSNRIQLREPTSGKAGADSKDSDKSSAPTA
ARPAMQVLAAPLQPAASLYGHMRNYSKRGLSYLSSSPKDYYGKFSTALAGGKRHYSEADD
ALAPDDVVQDPEDDMGAEEHEKRFQQHFALPETEKLLAVFYCSLHRVLPLYGKIYIGARN
FCFRSLLYGTRTKIVIPLKNIDNLEKEKGFRWGYPGMVVVIRGHEELFFDFSAGGLRDDC
VVTVFRAVEKAHALQESTILSEHEKEEAEAAAAERDLLHGARNAGQKSSPIETRQDADPV
LYEVPPVLFDDLSASMLDFKPKQPLRITCLTIGSRGDVQPYIALCKGLKAEGHHPRIATH
HEFGSWVKKHGIDFVPVEGDPAELMRICVEYGMFTPSFLLEVNSKFRGWLDTLLNSAWEA
SKGSDLLIESPSAMAGIHIAEALGIPYFRAFTMLWTRTRAYPHAFSVPTRKLGGHYNYYT
YTIFDNLFWRITSGQINRWRWKSLGLQPTSLEKLQQNKVPFLYNFSPSVVVPPLDFSDWV
RVTGYWFLDEGDAWTPPDDLKAFINQAREDKQKLVYIGFGSVTVADSKQLTQQVVNAVLK
ADVRCILSKGWSDRLETKDPGAVEVPLPPSVFQIRSAPHDWLFRQIDAAVHHGGAGTTGA
SLRAGVPTIIKPFFGDQYFFATRVEDLGVGIHLQKVTVNTLGRALWIATHDERMRTKARV
LGERIRSEDGVGTAIKAIYRDLDYARSLIKKRPKQTESGLELEEPEEESWTFVENDGDVT
IEELQTDSESTAQDSEG

Enzyme Prediction     

EC	2.4.1.173:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	927	1340	3e-56	0.9790575916230366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.83e-76	925	1338	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
275402	PH-GRAM1_AGT26	1.86e-54	271	390	1	116	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
224732	YjiC	8.53e-53	926	1356	3	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
275403	PH-GRAM2_AGT26	1.06e-44	753	844	1	92	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 2. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
397255	Glyco_transf_28	4.25e-28	927	1062	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO22200.1|GT1	0.0	5	1376	11	1412
QIW95533.1|GT1	0.0	27	1378	26	1324
SMR56257.1|GT1	0.0	23	1359	43	1417
SMR54150.1|GT1	0.0	23	1359	43	1417
SMY25439.1|GT1	0.0	23	1359	43	1417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.06e-172	907	1373	2	478	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	6.13e-172	907	1373	22	498	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.02e-23	925	1361	1	409	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.24e-22	933	1349	9	388	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1PN3_A	7.76e-20	925	1305	1	352	Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S1I0|ATG26_NEUCR	0.0	194	1358	282	1449	Sterol 3-beta-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=apg-12 PE=3 SV=1
sp|A1CFB3|ATG26_ASPCL	0.0	33	1381	33	1377	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1
sp|Q8NJS1|ATG26_LEPMC	0.0	29	1381	29	1410	Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans OX=5022 GN=ATG26 PE=3 SV=1
sp|A1CYS1|ATG26_NEOFI	0.0	49	1381	54	1381	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|Q5B4C9|ATG26_EMENI	0.0	183	1352	186	1323	Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997313	0.002691

TMHMM  Annotations     

There is no transmembrane helices in OTA39691.1.