CAZyme Information: OTA38320.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA38320.1
• CAZy Family: GT31
• CAZyme Description: putative pectin lyase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		39949.16	6.2102

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000011:162937-164189(-)

Full Sequence      

MKTSLLSFLAAQAASIAAVSVSGTAEGFAKGVTGGGNAAAVYPSTTDELVSYLQDDQQRV
VVLQKTFDFRGTEGTTSATGCAPWGTASGCQTAINQNGWCDNYQPDAPHVSVSYDNAATL
GITVKSHKTIIGQGNSGAIVGKGLRIVSGASNIIIQNIAITDLNPQYVWGGDAITLNGAD
LVWIDHVTTARIGRQHIVLGESADNRVTISNCYINGYSQWSAKCNNHHYWAIYLTGSNDL
VTMKNNYIYYTSGRGPKVGGNTLLHAVNNYWYQVEGHAFEVGSGAQIVAEGNIFQNVDYP
IQQGAIDGRIFTSPSTGANQVCNSYLGHNCVLNAFGSSGDFTGTSDTSFLVNFNGKNIAS
AQSTSGLASSIQANAGQGNL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	112	296	9.8e-86	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.64e-50	110	298	2	190	Amb_all domain.
226384	PelB	1.40e-14	122	326	97	300	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.50e-12	122	294	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64674.1|PL1_4|4.2.2.10	1.34e-164	5	380	7	379
ABF50856.1|PL1_4|4.2.2.10	1.34e-164	5	380	7	379
QMW36680.1|PL1_4	2.69e-164	1	380	1	379
BAE65999.1|PL1_4	2.69e-164	1	380	1	379
QRD92257.1|PL1_4	2.69e-164	1	380	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	2.97e-157	19	380	1	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	5.63e-155	19	380	1	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	2.75e-143	21	378	3	358	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WV10|PELA_ASPFU	4.53e-168	10	380	12	380	Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelA PE=3 SV=1
sp|A1CYC2|PELA_NEOFI	1.39e-166	14	380	14	378	Probable pectin lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelA PE=3 SV=2
sp|Q5BA61|PELB_EMENI	2.37e-165	5	380	7	379	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q2TXM4|PELA_ASPOR	4.78e-165	1	380	1	379	Probable pectin lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelA PE=3 SV=1
sp|B0XT36|PELA_ASPFC	9.28e-165	14	380	14	378	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.357194	0.642803	CS pos: 17-18. Pr: 0.4221

TMHMM  Annotations     

There is no transmembrane helices in OTA38320.1.