CAZyme Information: OTA38301.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA38301.1
• CAZy Family: GT3
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TQV2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		57116.42	5.6754

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000012:114344-115989(+)

Full Sequence      

MTGSHSQAHTGDNNSGSTAAEPSPYTLSQQNTSIDISGTSVRLSMHLHAASIASTQNSTL
PNSCKILIVGDSITQGHEGDHTWRYRLWQWLRSNVTSQGFTFVGPYTGTDPPAAPRPPQP
PRLGSDEPEEPEDSESTVKADGKYAADVPADFQGNHFSGWGWQLGQAKDMIRDVVSVYKP
DLILPLLGFNDIGWGFCQASEVLHRMRDFIQEARAAKPDVALLVGNIPQRRYMNGRQDLL
ENTIEYNQQLPRLLDAMRSDLSPLHAVNVAQCYSCTPNGCPAGYDGLHPNILGEFQIARA
FSLTLHDFFGIGDAALEVPSPQDMPQRPSHVPTNVVATGAPMGVTVTWDAVFGARGYDVR
NRTQGKDKWEVAQAQSNRFDTTFTVAGIAWEYQVRTNNGDGDKDRSDWSPVSAAVARRDT
APPPRNIQTFSKDHSIRATWSPVEGGWEVDRYAVTILDQDTPGAIIICYGFRGTEATLHG
LRNGHCYSVFVGTWAFVDGVSVGGLPAQAASVTPGILSEGNRTH

Enzyme Prediction     

No EC number prediction in OTA38301.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	65	302	4.5e-44	0.9742268041237113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.27e-29	154	305	15	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	2.81e-07	158	301	44	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	2.21e-06	165	302	48	189	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	5.58e-06	173	293	55	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	5.31e-05	137	301	35	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ09962.1|CE0	6.85e-113	65	515	513	952
SCG40251.1|CE0	1.12e-105	65	515	337	773
CAK39824.1|CE0	1.27e-65	54	334	127	394
BAE63679.1|CE0	1.58e-61	55	334	48	317
AVT40037.1|CE0	4.80e-60	66	515	345	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	8.28e-07	65	298	3	192	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	2.03e-06	65	298	3	192	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

OTA38301.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999498	0.000514

TMHMM  Annotations     

There is no transmembrane helices in OTA38301.1.