CAZyme Information: OTA37899.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37899.1
• CAZy Family: GT22
• CAZyme Description: Cutinase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TPI4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156		15482.19	4.9429

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000015:319687-320157(-)

Full Sequence      

MGTVVGPGLAKDLHNIAGQNAVSIQGVDYPASAAGNAQLGASGGPEMVKLAQSAMQQCPK
TKLVLGGYSQGAMVVHYAMKNGIDASNVGAIAVFGDPLNGQSFGDVPDSKVSNNCGSSDF
ICATGPSNGSGSHLSYGSDLESAANFIVKTTGEGSS

Enzyme Prediction     

No EC number prediction in OTA37899.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	2	149	1.2e-33	0.8835978835978836

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.80e-29	3	149	20	171	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO13042.1|CE5	6.23e-43	1	152	243	396
CBX94902.1|CE5	9.72e-42	1	152	150	302
BAE58644.1|CE5	2.12e-40	1	152	62	209
SMR42758.1|CE5	2.75e-40	1	152	243	395
CAP91879.1|CE5	3.56e-40	1	152	174	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	7.00e-22	1	148	96	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1CUH_A	3.54e-10	1	149	48	205	Chain A, CUTINASE [Fusarium vanettenii]
1CUF_A	6.78e-10	1	149	48	205	Chain A, CUTINASE [Fusarium vanettenii]
1CUB_A	6.78e-10	1	149	48	205	Chain A, CUTINASE [Fusarium vanettenii],1CUC_A Chain A, CUTINASE [Fusarium vanettenii],1CUD_A Chain A, CUTINASE [Fusarium vanettenii],1CUD_B Chain B, CUTINASE [Fusarium vanettenii],1CUD_C Chain C, CUTINASE [Fusarium vanettenii]
1CUZ_A	6.78e-10	1	149	48	205	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	4.41e-37	1	152	77	222	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|A0A024SC78|CUTI1_HYPJR	3.24e-21	1	148	96	244	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	3.24e-21	1	148	96	244	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2
sp|A8QPD8|CUTI1_TRIHA	4.53e-21	1	147	96	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q00298|CUTI_BOTFU	7.13e-21	1	152	48	201	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA37899.1.