CAZyme Information: OTA37811.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37811.1
• CAZy Family: GT21
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MUNK01000016|CGC3	48629.63	4.2342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000016:252997-254482(+)

Full Sequence      

MKYTIALFSAAVMVTAAQPHRHAHQHLHKDRREALPNPAADPDVVVVPGPTEIAYVLNGN
PISESDVMEGIKNGTLVWKNGGSLSSVASSEQPSATSYNEPSSTSTSQWVAPTTSSESSW
EPESTSQAWTSSSEASSSSSEPSTSSSSYSAPASSSASSSSSSGGDDSDFDHDYSNGLDT
DFPDGELDCDTFPSDYGAVAVNWMGLGGWTGIQSPGSLSKRGGFSNIKTITSNLCLGGSC
CSEGSFCSYACPAGYQKSQWPTTQGSTGQSVGGIKCENGKLRLTNPDLSSKLCMTGTDKV
NVVVQNKLSNNVAVCRTDYPGTESETVPVNAQPGSTSNLTCPDADNYYKWQGGHTSAQYY
VNPAGVSVDNACQWGSDANPWGNFAPLNLGVGYSNGAAWLSIFQNLPTTSQKLDFAVEIT
GDGLSGTCKYSNGQYCSGENYDQCSSSTGCTVSLSSGTATIVFSDS

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	139	463	3.5e-98	0.9702970297029703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	2.26e-129	184	451	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA29332.1|GH132	1.75e-174	37	466	34	435
UJO12597.1|GH132	1.75e-174	37	466	34	435
SMR44353.1|GH132	8.90e-165	1	465	1	426
SMR42173.1|GH132	8.90e-165	1	465	1	426
SMQ45830.1|GH132	8.90e-165	1	465	1	426

PDB Hits     

OTA37811.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	3.41e-112	175	463	139	413	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	1.86e-100	1	464	1	447	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|O43015|YBOH_SCHPO	2.88e-72	179	459	56	314	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|Q59NP5|SUN41_CANAL	1.37e-70	181	462	160	415	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|B5VMJ0|UTH1_YEAS6	1.58e-70	181	463	105	361	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000327	0.999642	CS pos: 17-18. Pr: 0.8994

TMHMM  Annotations     

There is no transmembrane helices in OTA37811.1.