CAZyme Information: OTA37808.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37808.1
• CAZy Family: GT20
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TP96]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MUNK01000016|CGC3	55168.99	8.2170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000016:280261-281875(-)

Full Sequence      

MFPFKNHQDTHWLAFSDWLIDWTPCVLVACYWVVCTAIFCMCSSRAIEVFYFFYMVINLY
IALCTAIESFLGLSPVRNARVAAIKVDEKSGKFPTSEDKLPIMDMIMVAYLPNEKDIVLG
QIMYALEEIVYPADKLRVNLVYNTPSPIEPLETQLRNLAADYSQLNIVKVPNSKSKADNL
NHFFSLPSTGADFTGIFDTDHLPHPYNVRWAAERFVKDGEKVDIVQGRCVVYNTSEGFLA
KMIAVEFDKIYAIAHPGRSRLFQFGLFCGSNGWWRSDVVRNIKMHGHMLTEDIDSALRAY
GSGKHAVHDMNVVSYELAPTTFGAFWKQRMRWTQGWTQASVKHMPLVWTDPSGGKRTKAE
RMGLVSLLFTRELSYYFVSQHTCLLLSFIISEWPTDVSSFVKLIFFRYPMAEWFLFATIA
ALLATLWFTNKVRSEFTSWKSMVYFSIVFIPYLVLQATMGLFGHARELTKYSNWNPTARK

Enzyme Prediction     

No EC number prediction in OTA37808.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	196	425	6e-18	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133045	CESA_like	6.01e-28	106	292	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.83e-25	59	454	15	392	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133049	CESA_like_2	1.54e-24	118	344	15	238	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133043	CESA_CelA_like	3.23e-21	101	338	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133059	CESA_CaSu_A2	2.62e-17	111	335	7	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY20870.1|GT2	2.43e-208	8	480	12	480
SMR46977.1|GT2	1.86e-205	8	480	12	480
UJO20854.1|GT2	3.01e-191	13	480	50	476
SMR45718.1|GT2	1.87e-184	3	480	6	444
QGA18997.1|GT2	4.02e-183	5	479	34	511

PDB Hits     

OTA37808.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P96587|YDAM_BACSU	1.52e-15	92	335	40	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000004

TMHMM  Annotations     

Start	End
20	42
49	71
408	430
443	465