CAZyme Information: OTA37806.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37806.1
• CAZy Family: GT20
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TP60]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471		51922.64	5.4075

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000016:328268-329740(+)

Full Sequence      

MRITPAVALVALTSPAIHAAPVPSLFGDIAAALQGAVGTVVTTITTEVQALSPLAQAVKK
LGATLQTNANIHGSKLGCNDLAIGTIEGVEAAISHAFQWPFLKKNFIDWKTYKANGVNLG
IWFEQEQNYDTEWWTENIGDFPDEWTWCGTVGFDVCGPKLEARYASWITTADIDKMGKLG
INTLRIPTTYAAWVKVPGSQLYSCNQQKYLRTITNYAIDKYNMHVIIGLHSLPGGINTLS
IGEAFGHDAWFQNSTNLDYSFKAIDSIISFIKNSGRPYGFTIAPLNEPSDNFAGFATPAG
LTENGTNWINTYIKGTLDRIAKYDKRVPLMLQDAFFSEMYWSPFYPAGTNLVIDSHIYFF
AAAGAYSQYVAPAICGQAKYIGEGDGKFPVFIGEWSLQSLYNNTLDNRKTLYDTQVYAYQ
KYASGGAFWNYRMKNGVDTVDGEGVLQDYWSWEGLANAGIPSVNKVNSSYC

Enzyme Prediction     

No EC number prediction in OTA37806.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	164	443	5.4e-125	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.92e-08	159	288	65	191	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ56129.1|GH5_23	5.73e-210	1	471	1	463
CCD33736.1|GH5_23	5.73e-210	1	471	1	463
UJO18386.1|GH5_23	7.03e-190	105	471	176	525
QGI92196.1|GH5_23	8.32e-157	106	471	71	437
QGI78478.1|GH5_23	8.32e-157	106	471	71	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	4.01e-116	106	469	11	372	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	4.26e-112	105	459	13	367	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
1EQP_A	1.84e-15	108	370	3	261	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	4.56e-15	108	370	9	267	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	5.88e-15	108	370	3	261	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29717|EXG1_CANAL	1.20e-14	108	370	47	305	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q12628|EXG_KLULA	1.53e-14	81	341	2	259	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1
sp|O93939|EXG1_WICAO	8.01e-13	105	342	29	263	Glucan 1,3-beta-glucosidase 1 OS=Wickerhamomyces anomalus OX=4927 GN=EXG1 PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	1.96e-11	108	358	31	281	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|P52911|EXG2_YEAST	5.63e-09	143	288	95	255	Glucan 1,3-beta-glucosidase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXG2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999696	CS pos: 19-20. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in OTA37806.1.