CAZyme Information: OTA37725.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37725.1
• CAZy Family: GT2
• CAZyme Description: Glyco_hydro_3 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TNZ1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
932		101065.36	6.8222

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000017:276783-279694(+)

Full Sequence      

MGSNDPTLDPTWSNNERVLGQLFMMGFEGPSVTPQIRKLIQEHHLGSILLTAKNLKSAEQ
TTRLVLELQRCAYDAGHPVPLAIGLDQENGGVNSLFDEIYIRQYPSAMGLAATGSRELAH
DVAKATAEEIAACGINLMMGPCLDVLTNARNQPLGVRTTGDDPQEVSSYGVAFMKGYKEA
GLASMGKHFPSYGSLEFLGSALDVPTITESLESLSLNALVPFRNAIKEGLDAMMVGGCAM
SSAGLNVMHACLSEQVVNELLRNDLRFNGVVISDCLEMEALSHNIGVGGGTVMAINAGCD
IVLLCRSFQHQQEALEGFKLGLENGMITNDRLRQSLRRVLQMKAKSTSWEKALNPPGISL
LSDMQPSHTTLSTKAYNSSITVVRDKNRLLPLTNILEPEDELLLLTPLVKPLVASAASRA
LTEHASSGSPDPAIWDRSASVMSGERVFRELGRSLARQRNGRVLHTSYTANGVRPQHENL
ISRAGAVIIVTADANRNLYQNGFTKHVSMICNMQYTSGGEKREKPVIVIAVSSPYDFAMD
QSIGTYICTYDFTETALTSLVKVLYGDLTPAGALPGSISQSQKLSQSKQHWLVETFNEER
DSHALDVLIKTTADGHTPGFKSELSSVSSNCFLLRNPDILEAHFVVRNSSTQAVYGFCST
YFFKATGTGVIGAIFVDPSRRKLSIGHSLHNRAIRTLLQRDDIKRFQLGSRLPSIYLGIP
TSHGGERKRLRSWFANLGWNTALSRSVCSMVARNLSTWTPPPGMAKSLQSAGADFDLVYG
WDYATPVLDHIKTNNRQGLAEVYKMALADPSACGIIRAKRPQDGSLVGTVCLYNMHSQLA
EFVPGMKAIGELAGGISSPVISPAVAEYSTLLQGLILLGIRQIKKQGCNACILDYMDGDG
NFDGFSAMGFDVAHAFEEVSCDAATWTMVPPS

Enzyme Prediction     

No EC number prediction in OTA37725.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	303	3.8e-52	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.08e-67	19	393	7	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.23e-57	19	340	6	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.19e-35	24	353	5	316	beta-hexosaminidase; Provisional
185053	PRK15098	2.95e-12	19	343	51	353	beta-glucosidase BglX.
178629	PLN03080	1.39e-07	104	392	114	415	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO20030.1|GH3	0.0	1	932	1	932
SMY21386.1|GH3	0.0	8	932	16	943
SMR47486.1|GH3	0.0	8	932	16	943
SMR46236.1|GH3	0.0	8	932	16	943
CAE7213699.1|GH3	0.0	8	932	7	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.46e-81	14	739	8	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.75e-61	19	579	17	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.85e-39	19	583	48	622	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.92e-38	19	583	22	596	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.65e-38	19	583	52	626	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.01e-38	19	583	48	622	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	2.18e-31	31	579	50	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	6.79e-31	19	575	32	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|Q0A911|NAGZ_ALKEH	7.65e-28	18	305	2	283	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
sp|Q6LJ30|NAGZ_PHOPR	1.19e-26	24	317	5	286	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA37725.1.