CAZyme Information: OTA37616.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37616.1
• CAZy Family: GT2
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TNM1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MUNK01000018|CGC1	72517.65	6.4078

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000018:102346-104265(-)

Full Sequence      

MIHLTAPAVNSRFAQYSISAIILLAAFWFILPSLDALPVRALHSHPKLDPDSPQTQTHAS
AAAAGKKADFLPKPNHPIDSLIARAEREFDELLAKETHTVHDAAAAYRERRGRQPPPHFD
QWFAFAQNHSTVMVEDFWDQIYHDLAPFWGVPAKTIREQANDFLHRISVRNGNTTQRTDI
KGREWLDLWEDMVRSVAPWLPDVDLPINVMDESRMVVPWEEIDSLMAKESKSRQVVSEAK
LKTQFETRKDLDEHPPPKFDPGFNGAGPYWPLAVVGCHADSPARSAYIETDFSTAPPISG
SEYPVGSYHGYVQNWTLAKSSCDNPHLQGLHGTFIEPISISNTKKLFPLFGGSKLPMNNE
ILLPPAMYYTSNPFYSGGKTHGQPWEDKTDSLIWRGAASGGRNREENWRRFQRHRFVSMT
NSTSIRLAETSQQPPQSFVMPSNNTYDLAATHIHPSSTDPHPFSSWIACWSDTAVVNLLC
FPGTGTNFCPYTDPYFHPAPVMPMKEQYAHKYLPDIDGNSFSGRYRGFLGSTSLPIKATI
YDEWHDSRLVPWVHFVPMDNTFGDLYGIMEFFVGYVSRDGQEGVGGRDEVAKKIALRGKE
WAERVLRREDMQVYVFRLLLEYARVCDDEREVMGWRESG

Enzyme Prediction     

No EC number prediction in OTA37616.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	332	625	1.9e-71	0.948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.44e-12	487	624	120	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.16e-09	502	624	208	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ49255.1|GT90	6.29e-296	8	637	7	615
SMR49083.1|GT90	6.29e-296	8	637	7	615
USW51901.1|GT90	1.68e-291	4	637	3	629
SMY22954.1|GT90	2.58e-288	8	637	522	1130
SMR50260.1|GT90	2.58e-288	8	637	522	1130

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.04e-06	510	624	237	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.42e-46	35	631	119	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	4.68e-08	508	632	360	473	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.385476	0.614511	CS pos: 36-37. Pr: 0.5819

TMHMM  Annotations     

Start	End
13	32