CAZyme Information: OTA37466.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37466.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	MUNK01000020|CGC1	84674.84	5.7290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000020:146082-148443(-)

Full Sequence      

MTDPLSKLSEVFHHHDRDQESPTVPSESQVYPGSDEAKAQYRARQVAQDAQLSSVQMTPG
APSGDAPPPPYAPPSGLPPDMSAKAGSASEKPLDASDTSAPLNGYPRPDFHRTVSDLVWH
SLNGPWDFVFDDTDTGLSDFWYAQPRLPDQGKRTIQVPYVFQCAASGIDERGVHEVLWYQ
RQIQDLRSSEAKERGDRLLLRCGAIDYHATIWLNGRYVGEHTGGHVPFDLDLSDAVALSG
YMAENTLTIRVYDSAFDVTQPRGKQYWGPKPESIFYTPSSGIWQNVWLEVVPRMRVVDGS
YGTILRSNDIEKGVVDARVAVQGRRAQEKCSVEVEASFYGIPVSKSGKKDLNKSEDFVRF
DLPMRLSQEALSKLPAALLQDAPLKDPFCWRNNTALWSPEHPALYDLTIRLYNSTNGEVI
DAVQTTTGMRSITWTHGDGTLRLNSRPYFQALFLDQGYWPSTLLTPPDPTACKRDIQLSK
AVGFNGCRKHQKVESPEFLYWADRLGFLVWGEMASPYNFSMTGCERFEAEWMAMIRRDLN
HPSIVAWTPCNESWGYPDLGGSKRQRDHLRSLVYKTKTLDPSRPVNDNCGWEHVCTDLST
FHDYADARGMRERCGDLQATLTRGKNMFLPAIQGRDGGEDDEGSRHMRGAPVFCSEMGGV
NIAVKNDDSRQGNWGYTTASDGQDLLRRLEELLMATVSGGHVCGIVWTQTTDIEQEMNGI
YTWDRREKMPAAQVAEVMDRVKKVYYDGLRKHW

Enzyme Prediction     

No EC number prediction in OTA37466.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	119	735	2.8e-99	0.6037234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	6.45e-33	121	585	14	445	beta-D-glucuronidase; Provisional
225789	LacZ	2.95e-32	120	586	13	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	1.84e-15	138	585	91	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	5.32e-11	121	292	3	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
397119	Glyco_hydro_2_C	6.01e-11	474	585	40	158	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR54940.1|GH2	3.99e-314	105	746	15	660
SMY25002.1|GH2	2.29e-313	105	746	15	660
SMR53262.1|GH2	2.29e-313	105	746	15	660
SMQ51362.1|GH2	1.35e-307	105	746	15	660
USW54063.1|GH2	4.60e-303	99	752	3	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.82e-60	102	741	26	582	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
1BHG_A	1.97e-25	122	604	21	491	Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],1BHG_B Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],3HN3_A Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_B Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_D Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_E Human beta-glucuronidase at 1.7 A resolution [Homo sapiens]
6ED1_A	1.87e-20	110	583	20	447	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6LEM_B	6.10e-20	122	585	13	439	Chain B, Beta-D-glucuronidase [Escherichia coli]
4JHZ_A	6.14e-20	122	585	17	443	Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O97524|BGLR_FELCA	1.37e-28	105	604	29	510	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|O18835|BGLR_CANLF	2.41e-28	105	604	29	510	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|P06760|BGLR_RAT	9.57e-27	122	604	41	507	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
sp|O77695|BGLR_CHLAE	3.95e-26	105	604	26	508	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1
sp|Q5R5N6|BGLR_PONAB	5.09e-25	122	604	41	511	Beta-glucuronidase OS=Pongo abelii OX=9601 GN=GUSB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA37466.1.