CAZyme Information: OTA37125.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37125.1
• CAZy Family: GT2
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TMA2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		38674.66	3.9642

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000023:41717-42775(+)

Full Sequence      

MWWPTLSVALSLSTATASLTYKGVDWSSTLVEEESGRTYSGRDGTSQPLERIFKDNGVNT
VRQRIWNNPSDGNYNLDYTLELGKRANDVGLDIFLDFHYSDTWADPAHQTTPAEWEGYDL
QGLASAVKSYTKSVLDSFASADIPLSIVSIGNEITAGLLWPVGDMNTSGGPFNVATLLQA
ASAGVRESNLASQPKIMIHLDNGWNWETQKWWYDAVLGENVLTLDDFDVQGVSYYPFYNS
EATLNALGMSLGNMRSRYGKEVMVVETDWPVSCPNPEYAFPSDAAEIPFSTAGQTTWMKE
VASAVESSGGNGVFYWEPAWVDNAALGSSCDDNAMFEWEGQARDSITVFGSI

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	21	349	5.4e-103	0.9970760233918129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	1.52e-123	21	349	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	4.47e-76	22	349	41	391	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO17911.1|GH53	5.86e-159	3	352	2	351
USW52354.1|GH53	7.25e-148	19	349	32	358
QRD06256.1|GH53	4.32e-147	7	352	5	352
CAE7013133.1|GH53	8.43e-146	6	352	7	357
AEO65375.1|GH53	1.25e-143	7	352	8	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HJQ_A	1.36e-139	18	352	1	332	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1HJS_A	5.52e-139	18	352	1	332	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
4BF7_A	7.91e-134	10	352	9	350	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1FHL_A	2.18e-124	18	352	1	334	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
1R8L_A	5.21e-49	22	349	26	388	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D3T4|GANA_NEOFI	4.49e-143	6	352	10	356	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
sp|Q4WJ80|GANA_ASPFU	1.98e-139	6	352	10	356	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
sp|B0XPR3|GANA_ASPFC	2.80e-139	6	352	10	356	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
sp|P83691|GANA_HUMIN	7.01e-139	18	352	1	332	Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens OX=34413 PE=1 SV=1
sp|P83692|GANA_THETO	2.84e-138	18	352	1	332	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007679	0.992294	CS pos: 17-18. Pr: 0.9145

TMHMM  Annotations     

There is no transmembrane helices in OTA37125.1.