CAZyme Information: OTA37046.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA37046.1
• CAZy Family: GT15
• CAZyme Description: Beta-xylanase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TM06]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199		21734.19	3.7352

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000024:99937-100598(+)

Full Sequence      

MENIWYNVIGPEYIPMAFAAAQQAIEDNDLSVKLYYNDYNIEYLGNKSLAAQDIVTELKG
RGIQIDGVGLESHFIAGSTPSQSAQEDNMRAFVNLGVEVAVTELDVRLNLPPNATTEAQQ
KLDYYNTVAACVAVDGCVGITVWDFVDTYSWIPGTFPAQGYGDLFLQPDGADTPLLKKAA
YDGCLEALEGEDYNNPLST

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	3	165	3.3e-42	0.49834983498349833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	6.89e-57	2	186	137	310	Glycosyl hydrolase family 10.
214750	Glyco_10	9.82e-50	3	155	98	244	Glycosyl hydrolase family 10.
226217	XynA	3.23e-28	2	160	160	317	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACS96449.1|GH10|3.2.1.8	3.76e-93	2	189	231	418
BBC47920.1|GH10	1.07e-65	2	190	163	341
AVA16958.1|GH10	4.18e-62	2	199	163	350
ATY46025.1|CBM1|GH10	4.86e-62	3	190	164	341
QGA19858.1|CBM1|GH10	1.74e-58	2	189	158	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XZO_A	8.45e-96	2	189	147	334	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6JDT_A	1.21e-60	2	188	141	317	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	6.38e-52	3	188	164	339	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
4F8X_A	7.31e-51	2	191	143	330	Penicillium canescens endo-1,4-beta-xylanase XylE [Penicillium canescens]
3WUF_A	8.31e-51	2	188	138	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	1.72e-58	2	189	158	335	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|B4XVN1|XYNA_STRSQ	1.65e-49	2	190	176	352	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	5.17e-46	3	183	233	401	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|O60206|XLNA_AGABI	2.82e-42	2	186	157	329	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|B7SIW2|XYNC_PHACH	2.36e-40	3	183	223	392	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA37046.1.