CAZyme Information: OTA36976.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA36976.1
• CAZy Family: GT15
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TLS4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464		51405.05	4.9687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000025:86460-87921(-)

Full Sequence      

MPAFGLLSVVAAAAAFISSNSNAHVAAIPRHNGYQHGRPGWGHNHAHYGTASGTYPSVAP
TATGTAPLSTGTATPGNVTYDFPETIRGVNLGGWLILEKWMNSSLFDGTDASDQYTFDQT
SDAAAKLQNHWDTYICEDDFRQIAELGINTVRIPIGYWAYDPDSSPYLTGADKYMEKALD
WARKYDLKVLVDLHGSPGSQNGFDNSGKSGEVNWQSGDNMKKSISILEIMAKKYGSMDYA
DVVWGLELVNEPLSWNPNNFTLNKEWAQEATDAVRAKAANKNLMVIMHDSFVNPKQWIET
GEALNGNATAETARFGMDRHLYQNQEDSDSELNQDQHIEKACKWANTDLLGRDNKLPVIV
GEFSAATNICAYPDYTTSAGDSCKVEGCQCSCNVWIEHWDQPLVQATRKFVEAQLDAFER
GSKGWFMWSWKGPGAWGLQNAAKYGLIGEKVTDRKYPDQCHNYF

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	129	431	9.8e-86	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.51e-42	84	464	16	398	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.66e-20	137	383	27	263	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO14299.1|GH5_9	6.25e-180	83	460	56	433
EAA59523.1|GH5_9	1.05e-82	84	461	108	485
CAX44539.1|GH5_9	1.33e-80	77	460	43	435
AOW25980.1|GH5_9	2.05e-79	77	460	43	435
CAA39908.1|GH5_9|3.2.1.58	2.89e-79	77	460	43	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PF0_A	6.72e-81	77	460	5	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PB1_A	6.72e-81	77	460	5	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	9.19e-81	77	460	4	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.88e-80	77	460	5	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	1.88e-80	77	460	5	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5X8|EXGA_EMENI	1.89e-84	84	461	27	404	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|P29717|EXG1_CANAL	3.64e-80	77	460	43	435	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q96V64|EXG_BLUGR	8.76e-78	78	460	28	416	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|O93983|EXG2_WICAO	2.51e-77	84	460	40	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	5.16e-77	79	460	35	415	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000345	0.999619	CS pos: 23-24. Pr: 0.8789

TMHMM  Annotations     

There is no transmembrane helices in OTA36976.1.