CAZyme Information: OTA36603.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA36603.1
• CAZy Family: GH92
• CAZyme Description: Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TKP1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
990	MUNK01000029|CGC2	108938.77	4.3283

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000029:76871-79961(+)

Full Sequence      

MRIFSIFSLLLLGALTASATDNGLTTAVTWDQYSLMVNGERVYIFSGEFAYERVPNPELW
RDILQKYKANGLNGVSIYFFWSYHSPREGVFDFRTPARDIQKLFDIAKEVGLYVIARPGP
YCNAETNGGGFALYTGDGSIGVPRSGDETYYEAWLPWIQEVDAIIAKNQITEGGNVIIIQ
MENELVEVQHDPDNTLVIYMEQLENATREAGVIVPTSHNEKGMRGQSWSTDYQDVGGAVN
IYGLDSYPGGLSCTNENTGFNVVRTYWQWFTNYSYTQPEYSPEFEAGWFSPWGADVFYDE
CTTELSPAFPDVYYKNMVGQQLTLLNLYMAFGGTNWGNLAAPVVYTSYDYSAPLRETREV
RNKFKQTKLLGLFTRVSKDLLKTEMESNGTGNAVSSSDIYSWVLRNGDNGAGFYTVQQQE
TPSRAVVSFEVYLNTSAGMVTVPDVELNGRQSKILTTDYHLGEHTLLYCSADIATYGIFG
DETVLVMYLNVGQKGEFAFKNAPRNMSFKTYGSTNVSASAGGKNATGSELTKYTYTQTAG
STVLRFSNGISMYMLDQETAWNFWASPTTLNPDVAPDEQVFALGPHTVRNVSLAGDVVSL
IGDNANSTSLEVFAGHKYSSIRWNGMELATKRTAYGSLKANAPGAEERSIDLPQLSWVTA
DSLPEAQPKYDDSEWVICNKSSSLSPETPLSLPVLFAADYKYYPGPYIYRGYFDGKRATS
ANATMQGGLAAGFTAWLNGKYVGGNTGDAEETSVSATLDFSGVSLNDKNNVLTIVTDYTG
HDETSTDEGVKNARGLLGVTLAGGNSTLNFTQWKIQGNAGADANIDPVRGSLNEDGIHGT
RVGWHIPGFEPTGDAWSEGSPLDGLNSSGIGWYITHFNLDIDQDLDVPLGIEFGTPENTF
ASVNLYVNGYQYGKYIPQIGPQTRFPFPPGVINNKGDNTIAVSLWAQTDAGARLDTASLF
AYEKYQTGFDFSQDWSELQPGWTSDRLQYA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	35	370	9.2e-83	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	9.48e-77	34	371	1	315	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	2.29e-64	380	562	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	1.08e-42	379	563	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	1.61e-30	838	950	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
166698	PLN03059	4.62e-29	5	408	7	382	beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPP54608.1|GH35	0.0	14	990	15	1001
BBN23886.1|GH35	0.0	1	990	1	982
CAP74292.1|GH35	0.0	1	990	1	982
APA12177.1|GH35	0.0	1	990	1	984
CAE7174475.1|GH35	0.0	22	990	22	985

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	1.88e-169	28	959	6	943	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	1.53e-164	28	959	46	979	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	4.24e-164	28	959	46	979	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	3.69e-158	28	969	46	987	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	1.90e-157	24	968	22	984	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UMD5|BGALC_ASPOR	0.0	3	990	7	984	Probable beta-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacC PE=3 SV=1
sp|A1DM65|BGALC_NEOFI	0.0	1	990	1	983	Probable beta-galactosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacC PE=3 SV=1
sp|A1CE56|BGALC_ASPCL	0.0	1	990	1	985	Probable beta-galactosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=lacC PE=3 SV=1
sp|B8N2I5|BGALC_ASPFN	0.0	3	990	7	984	Probable beta-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacC PE=3 SV=1
sp|Q4WNE4|BGALC_ASPFU	0.0	1	990	1	983	Probable beta-galactosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999772	CS pos: 19-20. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in OTA36603.1.