CAZyme Information: OTA36337.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA36337.1
• CAZy Family: GH79
• CAZyme Description: Fn3_like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TJZ9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799		86887.44	4.6397

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000033:28125-30524(-)

Full Sequence      

MVVFRSLAVSLASALTLANAQWGHGHDKGHSSDSSLANAPYKDPSVPIEDRITDLLGRMT
IEEKAAQLMQGDISNWLNTTSGAFNETGLAVNFDQKAGMFYVGYPISWDWLATNIKRGQD
YAVNETRLGIPTIVQTEGIHGFLIGNATLFNSPIGYACTFNRTQTQLMAEQIAREAKALG
VNQLFAPLADLARELRFGRVEETFGEDGYLAGETAKSYIHGLQSLNVSAMLKHYAAFGDP
DQGLNTGPQHFGERALRTTWLPSYHKAVTEGGAWAIMSAYHSQDGVPAVSDHFTLTEILR
DEWGYEFFVMSDAGGTDRLAKNFYVCPLPLNDYNSPITEGNECVAMNALPAGGDVEMGGG
SFNYRSIPELVASGRLSEDTVNTAVTRLLRSKFTMGLFENPYPAAPASEWKDIINNDYAK
SLAREIDRDSIVLLKNNAETLPISKDKKVAVIGPMADGFMNYGDYVVYRSQYRGVTPLAG
IRDAIGNDSVSYAQGCERWSNDESGFSEAVAAANSADVAVVVVGTWSRDQRELWEGLNAT
TGEHVDVNDLSLVGAMRPLLRTIIDTGKPVVVVFQSGKPITEPWLSNTTASLVQQFYPSQ
EGGHALSDILFGDVNPSGKLSVSFPHSVGDLPVNYDYYNSGRPVDPGFVGADGNLYFGHQ
YVLGTPEPWFPFGYGLSYTDFAYENFSLSKTNVSASDSLVASVRLTNSGQRAGAEVVQLY
VKDLLASVDGPNMLLKGFEKVFLQPGETVQVEIPLDVRDCGVWQGRPGKMRWVVEKGDFL
VMVGGGSGDLRVNGTFTVA

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	124	357	2.2e-56	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.14e-144	6	797	8	763	beta-glucosidase BglX.
224389	BglX	8.02e-74	59	497	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	7.29e-67	40	756	41	743	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	6.51e-62	431	678	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.09e-52	60	390	1	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO23178.1|GH3	0.0	30	799	22	789
USW53662.1|GH3	0.0	5	798	6	789
QKX60989.1|GH3	0.0	1	799	1	778
BCS20094.1|GH3	0.0	41	798	29	778
QGA14555.1|GH3	0.0	37	799	23	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EAP_A	0.0	41	798	7	756	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	0.0	41	798	7	756	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5Z87_A	9.86e-111	37	791	32	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	7.88e-110	50	791	11	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.23e-109	50	791	11	745	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	5.51e-112	52	784	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	3.28e-109	52	784	38	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	3.50e-107	119	787	55	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|T2KMH9|PLH34_FORAG	2.40e-92	41	791	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	4.55e-92	127	798	34	674	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999757	CS pos: 20-21. Pr: 0.9656

TMHMM  Annotations     

There is no transmembrane helices in OTA36337.1.