CAZyme Information: OTA36131.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA36131.1
• CAZy Family: GH76
• CAZyme Description: Beta-glucosidase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1007	MUNK01000035|CGC2	108519.59	4.3958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000035:30999-34397(+)

Full Sequence      

MVDFCCWSAVLAWQHAVRTGVQLHPNMTFLRSALLAALPLNALAQLGPTAAPYPDSTYQN
ATEEYTTEDALTNATSPPKYPSPWGEGLGDWDRAYAQARDFVSQLTLLEKVNLTTGVGWQ
SEKCVGNVGAIPRLGFKALCLQDSPLGVRNADYVSAFPAGVTIASTWDRELFYQRGYDMG
SEHRDKGVDIQLGPVVGPIGRAPEGGRNWEGFSPDPSLSGIAVAETVKGIQAAGVMACTK
HYIANEQEHFRQGPPPGYLEASLSSNIDDITMHELYLWPFADAVRAGTASIMCSYNQINN
SYACQNSYVQNYLLKNELGFQGFILSDWQAQHSGVASALAGLDMTMPGDVVFNSANSFWG
TNLTIAVLNGTVPQWRLDDMTTRIVAGWYYVDRASNQAENAPNFSSWTDDTYGFEHYYAE
EDYTQINWHYDVRQNHAADIRNQAAKGTVLLKNTGALPLTGKEQLTAVFGSDAGENPWGP
NGCADRGCDMGTLAMGWGSGTAEFPYLVTPLEAIKAKVRSNGKSIEGITDDYAYSQINSL
ANSAAQVDGACIVFANADGGEGYVVVDGNEGDRNNLTLWHNGNDLISNVSSYCPNTIVVM
HTIGPVLVDSFYENPNVTAIIWAGIPGQESGNSIVDVLYGDENPGGKSVFTWGRNRGSYG
VDLLYEPNNGVLAPQQDFEEGVFIDYRAFDRLDETPIYEFGFGLSYTTFSYSNLNVQNMN
AGEYTPTEGNTPSAPVLGSISNNTSDYLFPDYINRIYAYIYPYLNSTNLRQSSADPMYGV
NHTYPPGAYDSGPQPYLPAGSRVSPGGNEALYDVLFTVTAEITNTGDVVGDEVPQLYISL
GGPNDPKVVLRNFDRLTIEPGQTKTFVADINRRDISSWDPSVQDWVVSSYPKTVHVGSSS
RKLPLSADLDTSGLVTGGGNGGNSGSSSSGSGASPTTTYGGGNGASSAPASYTSMGAGYS
YHAGQPTTMKTGYWGQHNGGWGKHDGDHGGHGDHGNWGPPSYMTKTA

Enzyme Prediction     

EC	3.2.1.21:43	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	130	347	1.7e-58	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	1.07e-52	448	686	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	4.61e-45	130	477	54	368	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.18e-38	157	883	120	738	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.32e-32	157	384	88	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.09e-29	96	712	51	639	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA29360.1|GH3	0.0	27	913	1	874
UJO11151.1|GH3	0.0	27	913	1	874
QIW95478.1|GH3	0.0	27	917	1	870
SMY23748.1|GH3	0.0	27	918	1	877
SMR51056.1|GH3	0.0	27	918	1	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NBS_A	0.0	74	905	18	852	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5FJI_A	0.0	74	909	4	840	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	0.0	74	909	5	838	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5JU6_A	0.0	74	909	23	851	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6SZ6_A	0.0	74	910	2	836	Chain A, Beta-glucosidase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D451|BGLA_NEOFI	0.0	74	909	33	869	Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglA PE=3 SV=1
sp|Q0CTD7|BGLA_ASPTN	0.0	74	909	24	857	Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglA PE=3 SV=1
sp|A2RAL4|BGLA_ASPNC	0.0	74	911	23	858	Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglA PE=3 SV=1
sp|Q2UUD6|BGLA_ASPOR	0.0	74	909	24	857	Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglA PE=1 SV=1
sp|A1CR85|BGLA_ASPCL	0.0	75	909	30	863	Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.305954	0.694038	CS pos: 44-45. Pr: 0.5990

TMHMM  Annotations     

There is no transmembrane helices in OTA36131.1.