CAZyme Information: OTA35784.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA35784.1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MUNK01000040|CGC2	41111.54	5.0080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000040:46887-48262(-)

Full Sequence      

MTRPLPAPEGDAESKNQQLELTSEDTLESLVSVGAPPTAAFHSASSSQEELDNPPKSKAD
SAAKGFAYAFYATSDSYACSALVNIYRLQHELGTKLPIHMLVSDGVSSPYIQSFEAAGVF
VHHQETPKLKSSMVGSYYEDCLLKLLAFKLHALDPRLKRVLALDSDQLVMQNLDHLFAGL
PEVDLAAPRAYWLSRDFLASTFMMISLSDRLWKTVEDALDTIGYDKFDMDLINDLLGDTV
MMLSGEYVTLNSHWEDWNLPKWYHPTQELNMTTIDIINDLAGSHGGIGKRQVERRPAPRF
PPTHPFTQELYDLQDAAAVIHFTAQGKPWARPVELTRAARPDAHPLLAAQFELWRETAER
VCPGGVPRS

Enzyme Prediction     

No EC number prediction in OTA35784.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	62	330	5.4e-24	0.8910505836575876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	2.87e-33	66	283	1	224	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	7.76e-20	66	356	1	239	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.23e-06	66	197	71	208	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133037	GT8_A4GalT_like	2.96e-04	70	329	4	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI68178.1|GT8	1.12e-71	67	366	43	306
QUC16913.1|GT8	1.43e-69	67	366	47	313
UPK95458.1|GT8	1.81e-50	67	329	10	251
AIG55795.1|GT8	4.64e-20	63	313	117	360
QQK48387.1|GT8	3.05e-17	66	292	55	319

PDB Hits     

OTA35784.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	1.89e-14	66	243	155	341	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	1.72e-08	66	243	80	275	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q6FQ15|GNT1_CANGA	1.20e-07	66	233	91	257	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q9Y761|GNT1A_KLULA	6.03e-06	66	196	96	229	Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999941	0.000087

TMHMM  Annotations     

There is no transmembrane helices in OTA35784.1.