CAZyme Information: OTA35750.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA35750.1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626	MUNK01000040|CGC1	68294.98	5.6186

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000040:112502-114602(-)

Full Sequence      

MAVNGQTNPRYPALSTSVDDFLQHKYDYVIVGGGTAGLVVAARLSENPDVTVGVLEAGKE
RLDDPLINTPAAFSQMFNDPQYDWCFRTEPQTENENKRHHIPRGKVLGGSSAINYMMYVR
GSSQDYDDWAAIVSDPGWSSSAMNQYMRKHQTLEPIDPAIIDRSTMPFVGEHHGTSGPVR
TSFNDTIVPLENDIIKACDEVTGFDRKPTDPWSGDHIGFFNTLGAVARTGPNSRRSYAAR
GYFEASALRPNLHVFCEATVTAVRLEGEKATGVHFRHAGVDHLVEVRREVVVSCGAIQSP
QILELSGIGDPDVLAAAGIECKVVNKAVGANLQDHCMTGVEWQLQPGIMTSDVMHNPEVM
AALQKQYMETGGGPLSSIVSMQGFFPYKLFASEAEQKEIIQSLETTLPTLTPFQRKQYER
IIEHLRSDHSANLQFVALPATADLDNGVEDQSKLITAPASPEAHGLTTALCLQYPASRGS
VHIKSTNVDDHPTIQPAFLTHPADAAVLGAGLRMVDRMIKSKHVSDKVLRRTHPDPSTDL
SDLDQAKDWIHKVVLSEYHPCGSCAMGDGVDTKLKVEGVQGLRVVDASIFPNHVSGNIVS
SVYMVAEKGADLIKADWDYAALDKVA

Enzyme Prediction     

No EC number prediction in OTA35750.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	616	3.5e-174	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.41e-111	23	614	3	532	choline dehydrogenase; Validated
225186	BetA	7.28e-105	25	616	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.20e-31	475	608	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.06e-30	10	605	39	568	Protein HOTHEAD
366272	GMC_oxred_N	3.58e-27	101	335	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO22487.1|AA3_2	1.64e-292	1	622	1	625
SMQ52591.1|AA3_2	2.90e-275	2	617	13	630
SMR55413.1|AA3_2	2.90e-275	2	617	13	630
SMR57790.1|AA3_2	2.90e-275	2	617	13	630
SMY26225.1|AA3_2	2.90e-275	2	617	13	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.52e-67	26	616	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.88e-66	26	616	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.08e-56	26	624	6	593	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
7AV4_AAA	6.54e-54	14	613	72	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	1.27e-53	14	613	12	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	1.36e-160	16	616	4	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.43e-157	15	616	3	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.43e-157	15	616	3	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	9.41e-86	21	616	35	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	7.73e-81	26	613	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999995	0.000039

TMHMM  Annotations     

There is no transmembrane helices in OTA35750.1.