CAZyme Information: OTA35480.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA35480.1
• CAZy Family: GH64
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MUNK01000044|CGC2	34396.05	3.7350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000044:204978-205907(+)

Full Sequence      

MGLPSSSSAPESYWPGWSGISRMFAFGDSYSTTGFNLSLTQPNESNPLGNPEYPGYTATN
GPNWVDFLTVTYNQTLLETVNLAYGGATVNSELIAPYQPTVLSMKDQILDEFVPVYADSP
DFFEWQANNTLFAIWIGINDVGNAYAQANSSVIYPLVMAEYASLLDTLYHHGARNFLFIN
VPPVNRSPLTLSAGAEAEATEATDISVWNANITHIATNLSTVYRDATTFVFDSNTLFYEV
LDEPCAYEETCPYTNTTGYCESYMNGTPEWDTFYSNCSIPVDEYFWLNSLHPTFRMMNVT
AQEIARQLS

Enzyme Prediction     

No EC number prediction in OTA35480.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	24	304	1.2e-74	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.50e-62	22	307	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.26e-18	23	304	3	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	6.17e-13	21	308	2	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	2.63e-11	18	293	27	318	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	7.59e-11	24	238	2	194	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO22905.1|CE16	1.22e-143	2	309	22	329
APA06788.1|CE16	6.72e-113	12	308	36	334
ATZ46260.1|CE16	3.12e-111	12	308	36	334
QRC99106.1|CE16	1.40e-105	9	309	21	322
CBY01773.1|CE16	1.11e-101	14	308	30	325

PDB Hits     

OTA35480.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	3.16e-55	23	305	34	294	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	6.28e-55	23	305	34	294	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.988557	0.011460

TMHMM  Annotations     

There is no transmembrane helices in OTA35480.1.