CAZyme Information: OTA34578.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA34578.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MUNK01000057|CGC1	91593.00	5.0766

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000057:177507-180138(-)

Full Sequence      

MRLLALLAAVLSTTLSTTFCSAHQSTAGVQGILQRRLPNHVDDFTFSLVNTTTGKSNHTF
LSKPQDHYTVSNGPNPGQIHISGTSPIALAAGLRWYLTTYCHVDLWWSLGSSQLHLLPAH
LPPLNSTHHGSSVVPWRYHFNTVTFSYTTPWWGWEDWERELDWLALRGVNLPLAWVGYEK
VLLEVLVEAGLEREEVVKGFLAGPGFQAWGRLGNIQGSWGGNGRELGESWIEAQFELQKM
IVKRMVELGMTPALPAFTGFVPRGIRDIYPDARVVNGSRWNGFPERYTNVTFLEPFDPLF
ARLQESFLAKQKAAIMENDPYSGDLEYLHNITSTTIASLKAADPQAIWLLQGWLFYSSED
FWTNDRIVAYLGGVADTDMLILGLFSESQPQWQRTSSYYGKLWIWCQLHDYGGNMGLYGQ
VENVTADPVKALGNQSSTMVGMGLTMEGQEGNEIMYDLLLDQAWSPSPLDSALYFRDWVS
VRYHGSPSCLPQGLYSAWDIMRGTVYNNTELDVANAVTKSIFVLSPNTTGLLNRTGHHAT
TIQYEPEILVEAWKQFYAAADGMPGLWANDAYRFDLTDITRQVMANAFYPLYSTFITASN
ISQPSTYNITTARHAGETLLRLLKDLDTLLTASGIAHFSLPAWIASARAWADPTPLLSST
TPTSTNASSPAVNTTTLTDRANFYEYNARNQITLWGPGGEISDYASKQWGGLVGSYYLPR
WEMFVDFILGNNGTSTPATAGGGSGGDEELVAEMEGFELEWQGRRWGDERLGEGFEVAPR
DALQREMGRVVESWTGVFKMESHVRPHSRNQWVPEKGRTY

Enzyme Prediction     

No EC number prediction in OTA34578.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	77	762	3.7e-181	0.9592760180995475

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	1.32e-172	137	466	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	9.85e-63	474	767	1	244	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	2.74e-26	27	122	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19502.1|GH89	2.59e-276	16	762	24	730
QKX62920.1|GH89	2.74e-271	25	800	20	755
QMW36661.1|GH89	2.18e-253	15	791	12	785
QMW48717.1|GH89	2.18e-253	15	791	12	785
ATY61147.1|GH89	2.85e-245	25	729	23	693

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.01e-114	24	729	4	660	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	3.02e-69	66	726	202	822	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	3.33e-69	66	726	210	830	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.02e-68	66	726	225	845	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	6.13e-120	21	729	43	752	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	9.44e-114	24	729	27	683	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000661	0.999317	CS pos: 20-21. Pr: 0.9071

TMHMM  Annotations     

There is no transmembrane helices in OTA34578.1.