CAZyme Information: OTA34385.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA34385.1
• CAZy Family: GH5
• CAZyme Description: Beta-glucosidase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984	MUNK01000059|CGC1	106208.73	4.3064

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000059:157848-161225(+)

Full Sequence      

MVDFCCWSAVLAWQHAVGTKVQLHLNMTFLRSALLAALPLNALAQLGPTAAPYPDSTYQN
ATEEYTTEDALTNATSPPKYPSPWGEGLGDWDRAYAQARDFVSQLTLLEKVNLTTGVGWQ
GEKCVGNTGAIPRLGFRALCLQDSPLGVRNADYVSAFPAGVTIASTWDRELFYQRGYDMG
SEHRDKGVDIQLGPAIGPLGRAPEGGRNWEGFSPDPSLTGIAVAQTVKGIQDAGVMACTK
HYIVNEQEHFRQGPPPGYLEASISSNVDDITMHELYLWPFADAVRAGTASIMCSYNQINN
SYACQNSYVQNYLLKNELGFQGFILSDWQAQHSGVASALAGLDMTMPGDVVFNSANSYWG
TNLTIAVLNGSVPQWRLDDMTTRIVAGWYYVDRASNEAENAPNFSSWTDDTYGYEHYYAQ
EDYTQINWHYDVRQNHAADIRNQAAKGTVLLKNTGSLPLTGKEQLTAVFGSDAGENPWGP
NGCADRGCDMGTLAMGWGSGTADNGKSIEGITDDYAYSQINSLANSAAQVDGACIVFANS
DGGEGYITVDGNEGDRNNLTLWHNGNDLISNVSSYCPNTIVVMHTIGPVLVDSFYENPNV
TAIIWAGIPGQESGNSIVDVLYGDENPGGKSVFTWGRNRGSYGVDLLYEPNNGVLAPQQD
FEEGVFIDYRAFDRLDETPIYEFGFGLSYTTFSYSNLNVQNMNAGDYTPTQGDTPSAPVL
GSISNNTSDYLFPDFLNRVYAYIYPYLNSTNLRQSSADPMYGVNHTYPDGAYDSGPQPYL
PAGSRVSPGGNEALYDVLFTVTAEITNTGDVVGDEVPQLYVSLGGPNDPKVVLRNFDRLT
IEPGQSKTFVADITRRDLSNWDPSLQDWVVSSYPKTVHVGSSSRKLPLSADLDTSGLVTG
GGNGGNGGSSTSGSGPSPTTTYGGGNGASSSPASYTSMGAGYSYHAGQPTTMKTGYWGHH
NGGWDKHDGDHGNWGPPSYMTKTA

Enzyme Prediction     

EC	3.2.1.21:43	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	130	347	6.1e-58	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	2.07e-43	448	669	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.03e-42	130	477	54	368	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	4.35e-38	157	866	120	738	beta-glucosidase BglX.
395747	Glyco_hydro_3	2.39e-32	157	384	88	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.18e-29	96	695	51	639	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA29360.1|GH3	0.0	27	896	1	874
UJO11151.1|GH3	0.0	27	896	1	874
QIW95478.1|GH3	0.0	75	900	30	870
SMY23748.1|GH3	0.0	59	901	18	877
SMR51995.1|GH3	0.0	59	901	18	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJI_A	0.0	74	892	4	840	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5NBS_A	0.0	74	888	18	852	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5JU6_A	0.0	74	892	23	851	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJJ_A	0.0	74	892	5	838	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
4IIB_A	0.0	74	892	4	837	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WJJ3|BGLA_ASPFU	0.0	74	892	33	869	Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglA PE=1 SV=1
sp|Q0CTD7|BGLA_ASPTN	0.0	74	892	24	857	Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglA PE=3 SV=1
sp|Q2UUD6|BGLA_ASPOR	0.0	74	892	24	857	Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglA PE=1 SV=1
sp|A2RAL4|BGLA_ASPNC	0.0	74	894	23	858	Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglA PE=3 SV=1
sp|Q5B5S8|BGLA_EMENI	0.0	76	892	29	859	Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.206164	0.793824	CS pos: 44-45. Pr: 0.6671

TMHMM  Annotations     

There is no transmembrane helices in OTA34385.1.