CAZyme Information: OTA34155.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA34155.1
• CAZy Family: GH5
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TDP1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552		61311.11	5.9903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000063:133599-135411(-)

Full Sequence      

MNTGSTGGLLATPHGASRGSQGMRLFSRRGLTCLGALLLVSLFYTLHQQGPNASNRFHTS
FNLKPSELAGRRYQVIEAFDHAWRGYSTYCMGHDSIHPVTNTCDDDFGGLGATAIDALSS
AIMFERSEVVTEILEFIAKVDFTKVTGGTSLQLFEVVIRHFGAMLSANDLLDGPFQHLEI
DHRLRETLLNQTVRLGDVLSCGFSTPTGIPRNWVDPALCATDSGTSNTLAGIGTLVLEFG
RLSDITGHRVYVEKARKAEQYLINPTSAEQMPFPGIYGSFVSVMNGQLMDSKGSWGSLAD
SFYEYLVKMYIYDRDFYATYLDRWRVAADSTIRYIASHAYGHPEWTLLPYWEGQRRFNAM
DSLSWFAGGNFVLGGMVTGNQTFVDFGLSIADTAGAMYKMTKTGLGGEFVVWTEDCLGNW
GDGTCTANNSVRLSDSSFKLRPEVLETWYYAYRATGDPKYREWAWSAFEVISKVCKTSTG
FSAISDVNAPDGGKKLDMQESFVFAEVLKYVYLLHLEDDGNALHVQDSRYGAKNQWVYNT
EAHPFRVVGRLV

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	78	547	7.3e-109	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.58e-151	78	547	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.08e-96	71	547	72	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW97079.1|GH47	2.06e-219	23	549	1	520
VDB95110.1|GH47	3.97e-131	36	552	5	523
AEO58874.1|GH47	5.27e-131	74	549	42	519
BAA08275.1|GH47|3.2.1.113	1.22e-129	64	547	33	508
SMR45751.1|GH47	2.95e-129	66	549	26	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.90e-131	75	547	9	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	4.22e-131	64	547	33	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	2.07e-114	75	547	19	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	7.73e-54	62	548	11	468	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	9.36e-54	62	548	9	466	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	7.00e-131	57	547	25	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	2.17e-130	64	547	33	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|A1CP08|MNS1B_ASPCL	2.45e-129	63	547	27	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	8.28e-128	78	547	49	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	2.09e-125	78	547	49	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999989	0.000021

TMHMM  Annotations     

There is no transmembrane helices in OTA34155.1.