CAZyme Information: OTA34150.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA34150.1
• CAZy Family: GH5
• CAZyme Description: Pectate lyase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TDT1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MUNK01000063|CGC1	34086.91	4.3286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000063:5516-6580(+)

Full Sequence      

MKLTTVAASPLLVGLATSAVVRRQTGDGPQGSTDATQGDLSARPPPRFPFPVTTFPIARE
TIVLNETMYIQPGEVFDGQMRRYERVEGSCNEQAEGTDADAVFNLLAGATLRNVIIGQHQ
AEGVHALGDAWVENVWWEDVCEDALTSKGLNTQLRVIGGGARNATDKIFQDNSLGGKYNI
TGFFAENFGSFYQSCGNCLNQAKRNATVQNVIAINGTRMGIINPNYGDEYRIKDSQIRDV
EFIVDKEIGNNQQTVPYTVGTGPDEQYALYNLTRDRITEYDGEALNVYIPEDPYPWLAEV
WPAMSGGDGTK

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	60	245	1.4e-69	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	5.26e-76	53	249	2	195	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC92752.1|PL3_2	5.63e-188	1	310	1	310
CBX99900.1|PL3_2	3.12e-183	1	311	1	322
UPK97488.1|PL3_2	1.36e-171	11	302	9	303
QPC59987.1|PL3_2	1.39e-166	10	302	11	302
CZS82099.1|PL3_2	3.98e-166	18	302	16	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	3.25e-23	63	196	4	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	6.01e-20	62	197	8	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	6.15e-20	62	197	9	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	5.16e-19	62	197	17	148	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	5.16e-19	62	197	17	148	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA88|PLYD_EMENI	5.99e-49	47	263	37	251	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	2.33e-47	11	270	7	253	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|Q0CJ49|PLYD_ASPTN	7.56e-47	47	263	29	240	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	2.13e-46	50	265	19	230	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	2.19e-46	50	265	20	231	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.358319	0.641661	CS pos: 23-24. Pr: 0.5747

TMHMM  Annotations     

There is no transmembrane helices in OTA34150.1.