CAZyme Information: OTA33983.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA33983.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		89820.91	4.7280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000066:130927-133626(-)

Full Sequence      

MLCLTLLATLAIGVVKGHRHENSREHVSLNDGWRFSRFEFNPDGVIYDYRPDLRNLTDAT
VLKPWILPTANRYILDSANHFESPEGPPQVEVEYAQTSFDDSAWQLVSVPHDWAIDGPFY
TDEEDPVVGGSMGRLPIQGVGWYRRTVYIDQSDSGKAISLDIEGAMSYAMVWVNGDLVGG
WTNPVHIGRYSTYITTTDITDDSAAVNAIVQGENAGARSAHVQVVTDIYSIEQHSRQLKV
AQSSPSSAKVSSGDHAAVDQTIVLPDPNLWGPRPEQNPNLYIAVTRLYAGRKAIDQYSTE
FGIRSVVFDPSQGLLINGYHVPVQGVNFHHDLGALGAAFNTRAAERQLESLQEMGFNALR
TACNPPAREVLTLADRMGIVVMDEIFDTWEYNKTENDFHLIFPEWHEPDLRNFIRRDRNH
PSIIAWSYGNEVIDQTLNETGPVLSRKLRGIVSEEDPTRLSTASVNSAKAGWPFPGTLEI
ISLNYQGQGIRTGPEYSNLSGIITPLSETAATVDTRGTYIFPVVDADGAPANDSSGTTPD
DGFVSAYGLYTANFGASPDKTFASLGRNPYVAGEFVWAGIDYLGEPSPFYTSRSSYFGIV
DLAGFPKDRYYQYQARWRPELPVAHILPHWDWSGREGEVTPAHVFSEADEAELFLNGRSQ
GRIVRGEYEYRFRWDEVKYEPGTLFVQTYRNGGAWANDTVCTTNEPAGLRLIADRSEIEA
DGADLAFVTIEVVDAKGRTVPTAANNVTFALDGPGKIVATDNGDPTSFVTFSSVTREAFT
GKALAIVRAHVGGRGPLKIAATSEGLNAGHVMVRAR

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	18	619	8e-81	0.6210106382978723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408349	Glyco_hydro2_C5	1.49e-40	709	811	1	102	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
225789	LacZ	2.17e-35	80	639	20	622	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	2.57e-26	104	431	19	417	beta-D-glucuronidase; Provisional
406696	DUF4982	1.34e-19	637	698	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
397119	Glyco_hydro_2_C	4.17e-19	314	431	8	135	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73882.1|GH2	0.0	24	816	49	909
CEI63685.1|GH2	0.0	24	813	38	895
QNA44208.1|GH2	1.67e-314	21	816	30	910
UKZ60430.1|GH2	2.13e-312	4	814	14	897
ANH81488.1|GH2	7.40e-310	23	816	42	917

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	7.37e-154	98	806	48	811	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	4.96e-136	93	813	22	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	2.11e-132	99	788	34	781	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	1.40e-112	92	813	24	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	2.63e-112	92	813	47	874	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	1.68e-152	92	815	59	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	3.89e-80	80	789	56	795	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	1.00e-38	98	754	49	737	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|P77989|BGAL_THEP3	1.03e-36	99	758	27	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KPJ7|PLH8_FORAG	2.39e-25	98	661	73	673	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999757	CS pos: 17-18. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in OTA33983.1.