CAZyme Information: OTA33982.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA33982.1
• CAZy Family: GH47
• CAZyme Description: TSPc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5TD81]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1360		149193.34	4.3666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000066:134091-139120(-)

Full Sequence      

MRAPSSTALLVLASLCIDQPFCFAQAQHGPAKDPKIKAKYRDACPEYQHYSRFSHRPYSD
GPMELPFQRPSQHCRTFESDLVEKIIKDFNETMVDKDLARIFNNAFPNTLDTTVRWHVDL
TDTHDTYAQQIFSSGSAEAWKGAQSFIVTGDINAEWLRDSTNQLAQYQRLAKKDKAIENL
ILGAINTQAEYVIESPYCNAFQPPPPSKLHPSDNGQGDNVHPAYQPSQVFECKYELDSLA
HFLRLSNEFFDNTGSTEFLTPRWYHALESLLRVLDEQSQSTFSPKTGAFQRQEYRFQRST
NTGTETLNLAGNGNPLNYGTGLIRSAFRPSDDATTLGFFIPGNAMMAVELKRASHILATA
GKPKLSEGLKARGESIEKGVWEHGVVQHAKWGYVFAFEVDGYGSSILMDDANVPSLLALP
YLGFVRPEERTYQNTRKMILSKSGNPYYLTGSDFSGIGGPHIGLQNAWPMSLLIQAMTSN
DDDEIMSLLEAVKRASPLGLVHESVNVERVKDYTRSWFAWANSVFAQTILDVAERKPHLL
FGPGSKAYNVGDSYVASSLDPRQSGQVQEPCAELSDLAQDNDTFLPADLTLSCLRSVPLF
KDEDALQLAGLKVFLEFQSDLDYYGEQMPSGWIYPAVNLTSSLEELTQKLEDDFYDNEYD
FQLDLYKLVSSAYDGHLIYIPDIVGVFQFLRVKSIADRSSDRSIQSEDLFSLMSVVQGDD
ELPSVFAYDDLDAMQDEEDAGFTPSSIEQINGEDVESWLNSYASQNGRSRDPDANYNSLF
QNLPVNGSIAAGGDTFGYSILYQGNETILGFTNGTNRTVSTVAALASNQTLEGVTDGESF
FQRFCNTTYNEKLQQVAASPANTTTPTTTTQVPYEPVSTQRLTPTNDAFPSPIITSADGN
IAGYFPDDNFEDLAVLSVPSFLSSQARIVEFENAVRQTLATANANNKTKLVIDLRGNGGG
STFLAYDLFLQLFPSQVPYGAGTYRQHQLFNFTGSALSAHEDLLRTEAGSDELSIAWFPF
NYRVALDAQGHPFESWDSLYDGPESNIGAPTSLVRHNLTEVSEDAVPIFGYGNDTMSQPQ
TFAAENIVMLTDGTCASTCAIFSEFMKTQVGVKSVAVGGRKQTGPMQAVGGTKGSRLMGM
GQLYYIVVTASQYAAPGDRLRLLSSFDTDEGNVLTAATKAIDRAAPGSDLLAQAGVNFRN
NIRQGDDTLTPLQFIYEAADCRFFYTPEMYARQEAIWERVYQWAWGGEENVCIEGSSGRD
SSSNGTSYYGTDLPDNARNFFGGNNTIFPRDSLSLAAENGTQTSSGGSTSGTSTGSSSES
SQGGSDGGNDGDNENGASVLLAPRAVGLVAALLMGYVLIL

Enzyme Prediction     

No EC number prediction in OTA33982.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	95	530	1.3e-159	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	95	530	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.33e-155	74	540	2	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
225922	SGA1	5.14e-06	336	525	412	597	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
143475	Peptidase_S41	0.001	909	968	57	110	C-terminal processing peptidase family S41. Peptidase family S41 (C-terminal processing peptidase or CTPase family) contains very different subfamilies; it includes photosystem II D1 C-terminal processing protease (CTPase), interphotoreceptor retinoid-binding protein IRBP and tricorn protease (TRI). CTPase and TRI both contain the PDZ domain while IRBP, although being very similar to the tail-specific protease domain, lacks the PDZ insertion domain and hydrolytic activity. These serine proteases have distinctly different active sites: in CTPase, the active site consists of a serine/lysine catalytic dyad while in tricorn core protease, it is a tetrad (serine, histidine, serine, glutamate). CPases with different substrate specificities in different species include processing of D1 protein of the photosystem II reaction center in higher plants and cleavage of a peptide of 11 residues from the precursor form of penicillin-binding protein; and others such as tricorn protease (TRI) act as a carboxypeptidase, involved in the degradation of proteasomal products. CTPase homolog IRBP, secreted by photoreceptors into the interphotoreceptor matrix, having arisen in the early evolution of the vertebrate eye, promotes the release of all-trans retinol from photoreceptors and facilitates its delivery to the retinal pigment epithelium.
397571	Peptidase_S41	0.001	912	975	1	58	Peptidase family S41.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21298.1|GH125	4.95e-305	1	552	1	542
SMR58294.1|GH125	2.69e-275	1	552	1	542
SMR61267.1|GH125	1.52e-274	1	552	1	542
SMQ53852.1|GH125	1.52e-274	1	552	1	542
QIW98952.1|GH125	8.24e-268	25	548	19	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	2.24e-89	69	540	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	2.94e-87	69	540	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	1.22e-81	69	540	21	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	3.58e-73	80	531	10	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	6.09e-73	80	531	10	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.16e-179	43	540	26	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1
sp|B8NM69|USTP_ASPFN	7.16e-47	803	1258	38	475	Peptidase S41 family protein ustP OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=ustP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999752	CS pos: 24-25. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in OTA33982.1.