CAZyme Information: OTA33352.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA33352.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MUNK01000077|CGC1	42785.87	7.0732

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000077:144970-146115(-)

Full Sequence      

MRRILLSQSQVSLFASSAVVFIFTLLLFLSGYVIQQRTVKGLQVAIKPRIPDPPPSLQLQ
RKDEGPQLQPSRHFRASDKVAFTNLDAVQQQRDSIDWTRLAHVQLARNHHDVCNAVMVLA
DLHRLKSPARRVLIFPEDWALDQQGKKHDISDPFLASSKRLLRMAARRYGVELRPVSPAL
RANDELDGSSNVYSLASAFALKDFDRILSVEAPGLIMDALPLDAVLAFTENTPFAMLQDS
HDDDGVHSADLLLLKPSASSHAKLLERLGMESNFNDSIIPTLFTDPLLLASKTDDHTLIR
SIGTLHQAAQDFNATAYLDRVSYIRFSDPKLPGPEYDVPWPQKVAARPSNKDADWTWTKL
YGEFAQKRMDVCGLDLETWRA

Enzyme Prediction     

No EC number prediction in OTA33352.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	9.58e-09	101	236	2	122	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO17613.1|GT0	4.55e-150	3	380	4	383
SMY23031.1|GT0	1.03e-145	5	380	2	381
SMR49164.1|GT0	1.03e-145	5	380	2	381
SMQ49335.1|GT0	1.46e-145	5	380	2	381
SMR50340.1|GT0	1.46e-145	5	380	2	381

PDB Hits     

OTA33352.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	2.83e-14	95	372	150	434	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	4.37e-10	93	266	73	239	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

Start	End
12	34