CAZyme Information: OTA33245.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA33245.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878		94847.96	4.4377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000078:113141-116646(-)

Full Sequence      

MALPKSPISSLLLMSACGLAKGRLSEYVDPLIGTEGSTPGSAIAGGNSFPGASLPNAVAK
VGIDTSYLGVPNGTAVDCNAGYSPLGNVTAISMLHVSGTGGVPTYGLISQMPLLGGLDSV
NFADNTTYWQNRSMGEESAQVGLFQTTLLNGIEIDITSTAHTGLLRYRFPAETDVAPRNN
LSTPAVQSEASDDGHGDDAHVLVDLTHVLPGYGTYAYSQKFLHGDLHLHTGANGSPSYLG
SATYTGGWSQPESQTLYFCGNFTSPNGNLQPSSDYVVQNTMESVQGAGTFSWPYNPLLPP
TYDERPVPRSYNDVLSYAGSGMGIGALFSWKPTSANMSAERVIEARLGVSYISAGQACAS
LAAEAPENRSFEDVVEDVKVDWEENVLGTIQVEDNGSQTNGNATLKRMLYTALYQTGLMG
ENPKWQTNASNPYYDDHYTLWDTYRTLMPLYHLLYTKTYADVLSGLISIFTNEGFLPAGR
IANWNGRVQGGTHADMVLGDAFTKDVVSLTGQRGRAELGSNIDWKEAYKAVLNDATNLPA
RNEDPVAFDGATQEGRGALDDQLPLHYITRNHTRSISRGVEYAQNDYAIYSMAKGLNGSE
SSTFRDRAGWWENQWNPYANTSLEGVGSFTGFPGARNQDGSWNFTDYDPLSCGGCGWGSD
IYEAKVWETAFAAAPHDMAKIIQLMGGDEQFIKRLDASFLPGFGTSVGENNDAGSALFNP
GNEPSFMTPFLYNYVPGYHWKTVNQTRATVDAFYGVGRDGYPGNIDGGALPSWLTFNLIG
LYPVSAQPIYLLSAPRFEALSIRLFGGTAQETRLNISAPGISDSNYYPQTVTFNGQKLNR
SWMTHYELGGGGELVFEMGENPSSWDTGERPPSLTAWE

Enzyme Prediction     

No EC number prediction in OTA33245.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	339	862	1.2e-129	0.9735234215885947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400362	Glyco_hydro_92	7.11e-148	356	859	1	464	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
226067	COG3537	9.86e-113	24	876	38	760	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
273488	aman2_put	1.30e-42	12	862	19	748	alpha-1,2-mannosidase, putative. The identification of members of this family as putative alpha-1,2-mannosidases is based on an unpublished characterization of the aman2 gene in Bacillus sp. M-90 by Maruyama,Y., Nakajima,M. and Nakajima,T. (Genbank accession BAA76709, pid g4587313). Most members of this family appear to have signal sequences. Members from the dental pathogen Porphyromonas gingivalis have been described as immunoreactive with periodontitis patient serum. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
407572	Glyco_hydro_92N	6.19e-36	27	350	1	231	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.
411518	lectin_1	3.15e-31	28	873	11	698	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD04981.1|GH92	0.0	5	877	20	899
CBX98301.1|GH92	0.0	9	877	22	922
USW53853.1|GH92	0.0	23	875	27	875
CAE7213590.1|GH92	0.0	18	876	33	897
SMY29914.1|GH92	0.0	13	877	9	882

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F8Z_A	9.96e-54	22	865	5	717	Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F90_A Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
6DWO_A	2.26e-39	350	875	217	710	Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_B Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_C Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_D Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
7FE1_A	4.02e-39	350	875	217	710	Chain A, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
7FE2_A	9.53e-39	350	875	217	710	Chain A, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
2WZS_A	5.95e-38	343	863	226	719	Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_G Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_H Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATR3|A7629_ARTBC	4.57e-78	21	876	27	760	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1
sp|O86365|Y584_MYCTU	9.03e-43	26	876	43	770	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.159954	0.840022	CS pos: 22-23. Pr: 0.5430

TMHMM  Annotations     

There is no transmembrane helices in OTA33245.1.