CAZyme Information: OTA32557.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA32557.1
• CAZy Family: GH35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289		31825.96	4.2035

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000091:7421-8351(-)

Full Sequence      

MRLSTTLTALAATFSTANAYWKGFNVGANNEDGSCKSQGDWEYAFNKLKGLPQYITSVRL
YASSDCNTLANAVPAALNTGTQILVGVWTEDNAHFQREKDALEAAINQHGSDWIIAISVG
SEDLYRGDTDANTLAQQIYDVRGMVRAMGVNQEVGHVDTWTAWVDDANKAVITASDFIGL
DGYPYFQSASIEDAYNVFWDSVTATRNQVNEVSPGKWVWVTETGWPVSGDNYGAGVPSVQ
NAQKYWRSVACSAFESIHMFWYSYQDYNASPSFGIFDSNGNAIYDLYGC

Enzyme Prediction     

No EC number prediction in OTA32557.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	53	286	4.4e-22	0.909967845659164

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.46e-53	22	279	46	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.70e-20	23	286	2	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW94742.1|GH17	3.11e-153	5	289	4	288
UJO17243.1|GH17	6.50e-153	1	289	1	289
USW52169.1|GH17	2.78e-147	1	289	1	289
SMQ48864.1|GH17	2.76e-133	1	289	1	289
SMR48682.1|GH17	2.76e-133	1	289	1	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.85e-29	23	251	39	252	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.29e-28	23	251	39	252	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUZ1|EGLC_ASPOR	3.07e-63	5	286	4	308	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	1.47e-59	5	286	4	308	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.61e-59	5	286	4	308	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.75e-58	5	286	4	308	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	7.64e-58	5	278	4	299	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999733	CS pos: 19-20. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in OTA32557.1.