CAZyme Information: OTA32392.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA32392.1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640		71145.94	4.2583

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000094:133294-135599(+)

Full Sequence      

MFVPLVTSALAATCAATALKYPRQSTNNTSSYAVKEPPLDTPWTYEAGTDPWPEYPRPQL
QRAQWQSLNGIWTYQNASSLDAVNNPPFNQALSSEVLVPSCLESGLSGIQGKDMLYSWFS
TSFDVPSQWTGERTLLNFGAIDYEATIFVNGQNASFHRGGYFAFTVDVTDYLATNGTNDL
LIFVHDPTDSEGYDIPIGKQTLNPSHIFYTPCSGIWQSVWIESAPADHITQLNIQAGMDG
QVNATVYSLNQAGSSVEISVVERGSNRSICTHQGTVDEAFTFSVDSPKLWSPDSPTLYDL
HISMGGDQVASYTGFRTVGRGEIDGIQRPLLNGEFVFQFGTLDQGFWPDGIYLPPNREAM
VYDIHTLKKLGFNMLRKHIKVEPALYYQACDEIGILVIQDMPSLRTGSQTLDNCTSVPIL
PNADQQAEFERQLDLLIVQQRHFPSIVTYVIYNEGWGQLRETLNPEFSLTDRVRQLDPTR
LVDAVSGWYDHGAGDFDDNHHYANPQCGSPFYSSPSGPYDPSRIGFQGEFGGTGNNVSID
HLWNVQAAIDTIDQTYEIDETLEAWNYRGHVLLGELRDQTAMYACSGGVWTQTTDVEGEV
NGLLTYDRRILRPDVTQWQADIQSLYDAAAARSNSSMAML

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	60	520	1.2e-96	0.5146276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	5.04e-34	67	492	14	480	beta-D-glucuronidase; Provisional
225789	LacZ	5.61e-29	66	454	13	406	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	1.17e-15	65	497	41	479	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	2.82e-12	228	316	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397120	Glyco_hydro_2_N	2.49e-10	117	225	67	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX54330.1|GH2	0.0	30	637	25	620
BCR88823.1|GH2	0.0	21	636	25	638
SMR58957.1|GH2	0.0	16	637	16	635
SMY28175.1|GH2	0.0	16	637	16	635
SMR62806.1|GH2	0.0	16	637	16	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	3.53e-108	39	614	12	571	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	3.03e-26	67	482	22	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	7.90e-26	67	482	47	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6U7J_A	6.24e-23	64	482	20	445	Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
6ED2_A	6.78e-22	118	480	94	467	Chain A, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	2.76e-26	52	490	40	473	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P05804|BGLR_ECOLI	1.07e-16	66	486	13	445	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|T2KM09|PLH16_FORAG	5.11e-16	118	487	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P77989|BGAL_THEP3	6.61e-15	117	402	58	348	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|P24131|BGAL_CLOAT	7.50e-15	66	610	47	601	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.294371	0.705605	CS pos: 16-17. Pr: 0.4756

TMHMM  Annotations     

There is no transmembrane helices in OTA32392.1.