CAZyme Information: OTA31852.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA31852.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1052	MUNK01000105|CGC1	115680.04	5.0959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000105:114611-118652(+)

Full Sequence      

MFPTTRQATAMALRAKPTTALQPFRVATASISSSTKKDAAPAEQQQSRLGLVKGNPGTPP
PMKGLKPRQEVPLPSQEGSNGVMQYALTTLDTITNWARQGSLWPMTFGLACCALEMMHLS
TPRYDQDRMGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPRWVISMGSCANGG
GYYHYSYSVTRGCDRIVPVDIYVPGCPPTAEALMFGIFQLQKKMRHTKITPCYSACLVCS
QQQRFFVSASSTMTRITKIITGLALTELALCQSGADILNFVNPLIGTVDGGHVFPGATLP
FGMAKAVADVNGEDQGGFASDGSNITGFSHMHDSGTGGSPSLGNFPLFPQAGCPGDILNN
CFFPKETRATPRINGSVRAHPGYFAVEMASNIKAEMTVTNHTALYRFSFPDTPVENNATL
SPLILADLTDLPDSRINGSVNVDEETGRITGSGSFSPSFGIGSYTLHFCADFNGAAVKDT
GVFMNNRAGSEPKNLSTVQDGVNNSPEILPAGAWTQFHAPEGDDNEILARVGVSFISVDR
ACKNAESEIPDFDFEGVHTAAQDAWTKTLGAVEVTPGEGVNSSLQTVFWSGIYRASLSPQ
DYTGENPLWNSTEPYYDSYYCIWDSFRSIHTMITILDPLSQVRMLRSLIDIYRHEGWLPD
CRMSLCKGFTQGGSNADIVLTDAYLKIKSISDGVDWATAYEAVVRDAEVEPENWSVQGRG
GLHSWKNLHYIPTEDYDPYGVGPFTRSISRTVEYAYDDFCIAEMAQEMGHDADAHKYFGR
SEYWRNMYLPTQNSSINGTDTGFTGFLQPRFLNGTWGFQDPIFCSPLLNFTSCYLNPDGH
ETYEGSSWLYTTFVPHDMASLITTLGGPDQFVKRLDYLHESGLLYIGDEQGFLPVFQYHY
AGRPGKSAERAHYYIPRLFNTTLVGIPGNDDSGAMGSFVALTMMGLFPNPGQDVYLITPP
FFEEWSITNPVTGKKATVRNRNFDAGYENLYIQSATLDGKVYRKNWLTHDFFLNGGVLEL
TLGRSESDWGTQEEDLPPSMSTNHHMTGYSLL

Enzyme Prediction     

No EC number prediction in OTA31852.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	511	1024	1.4e-158	0.9898167006109979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400362	Glyco_hydro_92	0.0	541	1023	2	464	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
226067	COG3537	3.47e-129	272	1049	33	767	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
235797	PRK06411	5.44e-102	76	229	14	164	NADH-quinone oxidoreductase subunit NuoB.
223454	NuoB	3.94e-94	65	228	1	164	NADH:ubiquinone oxidoreductase 20 kD subunit (chhain B) or related Fe-S oxidoreductase [Energy production and conversion].
273896	nuoB_fam	9.60e-92	87	225	4	143	NADH-quinone oxidoreductase, B subunit. This model describes the B chain of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoB. The quinone is plastoquinone in Synechocystis (where the chain is designated K) and in chloroplast, where NADH may be replaced by NADPH. In the methanogenic archaeal genus Methanosarcina, NADH is replaced by F420H2. [Energy metabolism, Electron transport]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO24429.1|GH92	0.0	249	1049	2	804
ATZ50561.1|GH92	0.0	276	1042	61	827
CCD49275.2|GH92	0.0	276	1042	31	808
APA15889.1|GH92	0.0	276	1042	31	808
QSZ32288.1|GH92	0.0	273	1043	29	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WZ7_K	3.97e-94	57	230	5	177	Chain K, Subunit NUKM of protein NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica]
6GCS_K	1.01e-93	57	230	32	204	Chain K, PSST SUBUNIT (NUKM) [Yarrowia lipolytica],6RFQ_K Chain K, Subunit NUKM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica],6RFR_K Chain K, Subunit NUKM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica],6RFS_K Cryo-EM structure of a respiratory complex I mutant lacking NDUFS4 [Yarrowia lipolytica],6Y79_K Cryo-EM structure of a respiratory complex I F89A mutant [Yarrowia lipolytica],6YJ4_B Structure of Yarrowia lipolytica complex I at 2.7 A [Yarrowia lipolytica],7B0N_B Chain B, Subunit NUKM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica],7O6Y_K Chain K, Subunit NUKM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica],7O71_K Chain K, Subunit NUKM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica]
6H8K_K	8.70e-89	85	230	1	146	Chain K, Subunit NUKM of protein NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica]
5LDW_B	6.59e-82	73	228	21	171	Structure of mammalian respiratory Complex I, class1 [Bos taurus],5LDX_B Structure of mammalian respiratory Complex I, class3. [Bos taurus],5LNK_6 Chain 6, Mitochondrial complex I, PSST subunit [Ovis aries],5O31_B Mitochondrial complex I in the deactive state [Bos taurus],6Q9D_S7 Chain S7, NADH:ubiquinone oxidoreductase core subunit S7 [Ovis aries],6QA9_S7 Chain S7, NDUFS7 [Ovis aries],6QBX_S7 Chain S7, NDUFS7 [Ovis aries],6QC2_S7 Chain S7, NDUFS7 [Ovis aries],6QC3_S7 Chain S7, NDUFB1 [Ovis aries],6QC4_S7 Chain S7, NDUFS7 [Ovis aries],6QC5_S7 Chain S7, NADH:ubiquinone oxidoreductase core subunit S7,NDUFS7 [Ovis aries],6QC6_S7 Chain S7, NADH:ubiquinone oxidoreductase core subunit S7 [Ovis aries],6QC7_S7 Chain S7, NDUFS7 [Ovis aries],6QC8_S7 Chain S7, NADH:ubiquinone oxidoreductase core subunit S7 [Ovis aries],6QC9_S7 Chain S7, NDUFS7 [Ovis aries],6QCA_S7 Chain S7, NDUFS7 [Ovis aries],6QCF_S7 Chain S7, NDUFS7 [Ovis aries],7DGQ_D Chain D, NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial [Bos taurus],7DGR_D Chain D, NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial [Bos taurus],7DGS_D Chain D, NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial [Bos taurus],7DGZ_D Chain D, NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial [Bos taurus],7DH0_D Chain D, NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial [Bos taurus],7DKF_D2 Chain D2, NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial [Bos taurus]
5LC5_B	8.18e-82	84	228	1	145	Structure of mammalian respiratory Complex I, class2 [Bos taurus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATR3|A7629_ARTBC	0.0	250	1040	3	758	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1
sp|O47950|NDUS7_NEUCR	5.25e-110	1	230	1	220	NADH-ubiquinone oxidoreductase 19.3 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=G17A4.170 PE=2 SV=1
sp|B5EN70|NUOB2_ACIF5	6.12e-81	78	227	2	153	NADH-quinone oxidoreductase subunit B 2 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31) OX=380394 GN=nuoB2 PE=3 SV=1
sp|Q0MQH9|NDUS7_GORGO	7.75e-81	24	228	12	205	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Gorilla gorilla gorilla OX=9595 GN=NDUFS7 PE=2 SV=1
sp|P0CB84|NDUS7_PONPY	7.75e-81	24	228	12	205	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pongo pygmaeus OX=9600 GN=NDUFS7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OTA31852.1.