CAZyme Information: OTA31730.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA31730.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1140		118909.10	4.6223

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000108:55406-59464(-)

Full Sequence      

MLHSLLTLAFASLLAQSNAQVTGSASGFATGVTGGGDATPATPADIDELKEWLTDDTPRV
IMLDKTYDFSGSEGSATETGCIPDSNTCGSSGQNALDGPDWCSADYPAVEVTYDVAAAEF
LDIKGDKSIVGVGDAGVIKGKGFRLSGGVSNVIFQNIHFTDLNSQYIWGGDALTLVGTDM
VWIDHCKFSLVGRQMILTGYEQAGRVTISNNEFDGVTEWSASCNNDHYWTMLFLGDSDKI
TLSNNYIHDTSGRSPKVGGSGDNTMHAVNNFWYSEGGHAFDVHEGGKVLIEGNIMQEVDT
PITESTAGGGGSVFNVPDSSAAATCSEYIGRECQVNSIVDSGDFPSYTATDVLSAFADVA
ESMVVAVAVDGLAESVKANAGIGKLSSSSSSTSSSSQVDAAEEGATSTSSSAPVATTSSV
AEEASSVAPVSSSIAAAATSSKPATSTATSVPSTSGGTGSIARYMQCGGASFGGGACEEG
LECTYFNDWYSQYETACELRRYDPSILTIGTPSIMAHRLFPKLTATPLQATAYLGGIALF
SISFLVFLNSTISFVVTDVIGQHEHVGNDVGTLGFADELLALVACPLWGLLSDRIGVRRV
AVTGYIIVGASLILLVKSTNVYPELLLGRLGFSLGGAACSTMVTAVLPAMVAKRTDSDDE
ETGTAPKNVHNEESHAAANGHAARLIEEERPGRNGSIGHGPSPSVSSEITITPGRYSSQS
RTRSRDERRDAARLPDENASDETSGTSQLAGLVGFFTGAGALVALLLFLPLPTYFQDRGE
DRPQSVRISFYIVGAIAFCVALFIFGGLRNLPGENEKSFSNLWRQPYDETTHRDERGQLH
ITLTPAPSYLKLVAESLKLGFTDPSIGLGYLGGFVARASSVGISLFIPLFVNAYFVRNGL
CTSNPDNLTDIKENCKRAYTLASALTGIAETAALICAPLFGWLGGKVVNGRSEWPLLGAA
AIGVGGYVAFGMLRNPDAFHSEGGRWAFLAVIMIGISQIGSIVCSLGLLGRGISRNAPST
ADRPSTSGTLTAGGHHIGASEGAETAALLPQRSNVTDQLSRDRSHLKGSIAGVYSFAGGA
GILLLTKLGGALFDSWTAGAPFFMLALFNGVLFVAVALVGAVNAVKASRGGNVGRETDDT

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	111	296	9.5e-84	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.83e-41	111	299	2	190	Amb_all domain.
226384	PelB	3.67e-16	5	385	14	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.33e-13	123	293	32	209	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
369468	MFS_1	1.13e-08	539	654	1	117	Major Facilitator Superfamily.
349949	MFS	5.72e-08	539	654	1	116	Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA08244.1|PL1_4	8.89e-131	22	385	22	383
ATZ48538.1|PL1_4	3.06e-129	2	385	1	385
CCD51274.1|PL1_4	3.06e-129	2	385	1	385
QMW40699.1|PL1_4	4.86e-122	1	387	3	384
QMW28629.1|PL1_4	4.86e-122	1	387	3	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.75e-97	21	385	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	2.40e-95	21	385	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	5.64e-88	19	384	1	359	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N316|PELF_ASPFN	8.63e-123	1	387	3	384	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	8.63e-123	1	387	3	384	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|Q5B3J8|PELF_EMENI	2.79e-122	9	387	10	380	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	5.99e-121	3	387	6	385	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	5.99e-121	3	387	6	385	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999729	CS pos: 19-20. Pr: 0.9793

TMHMM  Annotations     

Start	End
525	547
596	615
625	647
749	771
786	808
868	890
921	943
956	973
988	1010
1071	1093
1103	1125