CAZyme Information: OTA31082.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA31082.1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1045	MUNK01000122|CGC1	117408.54	6.9386

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000122:19565-24298(+)

Full Sequence      

MDFGSPEGTGAAASSPHLHAPPHQPRHRSNTSASRSPTTIFRSNTVRRNSATPSVELPPS
AAAADNATGDRGDSPPGSNNNNGNPRFSFDRRQSNLSRVSTVASDSSGIRYRKPERTNTI
TSYHLPEEPHPHFQPGAEPGIDTSAASDVLPPHLASLQKECKINIFDISLDEVRHTQALN
DDLPAVLAEERDMNLPCRWISVNGLSWDVIKALGNKYSLHRLAIEDLLHPSTRTKVDWYA
DHAFVVLTLQKLVRLHQHRWGEGRCNCPATEDFAGDEKLNREHKSSKGQASWKKWWQQYS
QKQSDVLPRYLDRNMDGKIDMFVPAHSGTSEDSPIREIRTLHRYESAQIPEHTAFMERHS
VLASEDLAVSVEQVSIFLTADNTVISFFEHSADDVETPIIDRLTSTETMLRRSCDASLML
QAIVDAIVDLAVPVKDAYNKTRKELQVDAMTNPDIRTSRALHIFGEEIDMLQNLFKPIVH
LVNALRDHNAEAVMPPRLGTGPVIHTEHDEKNQPKKQTKRDREGEPLFTRTVSDVQRAAM
KPRAAATSVAITPLAHTYFGDVLDHCITIIGALEQMDASASNISTLIFNTVGAKTNNFMM
ILAVVTVFFAPLTFISGYFDLRHRHQLTATMAEEAFKIAKEWEHRMPPWADAQPQPPQNL
DQITQRAIDIFMMSKKPNGEMGGIGWWQTGNGYTAIALRDYWAGSKHNYDMLANIIKQCE
GHHRGLINEFNDDTLWWGMCCMDMYNIGGDPWFLDIARGIYRHIHSRNSVCAPGQIKFQD
RDMEGACFWTTKPDEGQINSISTGLLCELSIRLALADRGGEKMQEKHPHLSKLQSFLDHG
QPSNDDYMRTAHCTLGWILRCRYRPRDGVVLDGIRLKKNEACDWTFSYTTGVVIGAAALM
YLATQEEKYMILACHMGHRAMRNKAWVEEDKGGILTEHGSYGHGRHDPAKNNDAVGFKSV
LLRELCTLYEVIRKTNAGSHIKEAERTANLIKTFVNLNFASQQQRNTNGNGQYGPWWNGP
FEMPTSHSQMAALDVMAAVHLVNRM

Enzyme Prediction     

No EC number prediction in OTA31082.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	677	1040	3.6e-42	0.8575418994413407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
213362	TmCorA-like_1	3.78e-25	198	617	3	252	Thermotoga maritima CorA_like subfamily. This subfamily belongs to the Thermotoga maritima CorA (TmCorA)-family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. Members of this subfamily are found in all three kingdoms of life. It is functionally diverse subfamily, in addition to the CorA Co2+ transporter from the hyperthermophilic Thermotoga maritima, it includes Methanosarcina mazei CorA which may be involved in transport of copper and/or other divalent metal ions. Thermotoga maritima CorA forms funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport by a related protein, Saccharomyces cerevisiae Alr1p. Natural variants in this signature sequence may be associated with the transport of different divalent cations. The functional diversity of the MIT superfamily may also be due to minor structural differences regulating gating, substrate selection, and transport.
397638	Glyco_hydro_76	2.19e-20	686	1033	35	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
213356	TmCorA-like	2.38e-14	199	619	1	249	Thermotoga maritima CorA-like family. This family belongs to the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. Members of the Thermotoga maritima CorA_like family are found in all three kingdoms of life. It is a functionally diverse family, in addition to the CorA Co2+ transporter from the hyperthermophilic Thermotoga maritima, it includes three Saccharomyces cerevisiae members: two plasma membrane proteins, the Mg2+ transporter Alr1p/Swc3p and the putative Mg2+ transporter, Alr2p, and the vacuole membrane protein Mnr2p, a putative Mg2+ transporter. Thermotoga maritima CorA forms funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport by Alr1p. Natural variants in this signature sequence may be associated with the transport of different divalent cations. The functional diversity of the MIT superfamily may also be due to minor structural differences regulating gating, substrate selection, and transport.
223671	CorA	2.11e-09	355	619	80	282	Mg2+ and Co2+ transporter CorA [Inorganic ion transport and metabolism].
396223	CorA	2.96e-09	551	619	186	254	CorA-like Mg2+ transporter protein. The CorA transport system is the primary Mg2+ influx system of Salmonella typhimurium and Escherichia coli. CorA is virtually ubiquitous in the Bacteria and Archaea. There are also eukaryotic relatives of this protein. The family includes the MRS2 protein from yeast that is thought to be an RNA splicing protein. However its membership of this family suggests that its effect on splicing is due to altered magnesium levels in the cell.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW95256.1|GH0	2.44e-158	633	1043	5	406
QRW18122.1|GH0	1.55e-26	655	1043	34	395
QRV89623.1|GH0	3.73e-26	663	1043	41	394
QRW03834.1|GH0	1.24e-25	663	1043	41	395
QRV74932.1|GH0	9.96e-25	678	1043	57	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JCF_A	1.37e-06	145	625	7	317	Cryo-EM structure of the magnesium channel CorA in the closed symmetric magnesium-bound state [Thermotoga maritima],3JCF_B Cryo-EM structure of the magnesium channel CorA in the closed symmetric magnesium-bound state [Thermotoga maritima],3JCF_C Cryo-EM structure of the magnesium channel CorA in the closed symmetric magnesium-bound state [Thermotoga maritima],3JCF_D Cryo-EM structure of the magnesium channel CorA in the closed symmetric magnesium-bound state [Thermotoga maritima],3JCF_E Cryo-EM structure of the magnesium channel CorA in the closed symmetric magnesium-bound state [Thermotoga maritima],3JCG_A Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state I [Thermotoga maritima],3JCG_B Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state I [Thermotoga maritima],3JCG_C Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state I [Thermotoga maritima],3JCG_D Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state I [Thermotoga maritima],3JCG_E Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state I [Thermotoga maritima],3JCH_A Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state II [Thermotoga maritima],3JCH_B Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state II [Thermotoga maritima],3JCH_C Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state II [Thermotoga maritima],3JCH_D Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state II [Thermotoga maritima],3JCH_E Cryo-EM structure of the magnesium channel CorA in the magnesium-free, asymmetric open state II [Thermotoga maritima],4I0U_A Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_B Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_C Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_D Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_E Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_F Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_G Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_H Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_I Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8],4I0U_J Improved structure of Thermotoga maritima CorA at 2.7 A resolution [Thermotoga maritima MSB8]
2BBJ_A	1.39e-06	145	625	10	320	Crystal structure of the CorA Mg2+ transporter [Thermotoga maritima],2BBJ_B Crystal structure of the CorA Mg2+ transporter [Thermotoga maritima],2BBJ_D Crystal structure of the CorA Mg2+ transporter [Thermotoga maritima],2BBJ_E Crystal structure of the CorA Mg2+ transporter [Thermotoga maritima],2BBJ_F Crystal structure of the CorA Mg2+ transporter [Thermotoga maritima],2HN2_A Crystal structure of the CorA Mg2+ transporter homologue from T. maritima in complex with divalent cations [Thermotoga maritima],2HN2_B Crystal structure of the CorA Mg2+ transporter homologue from T. maritima in complex with divalent cations [Thermotoga maritima],2HN2_C Crystal structure of the CorA Mg2+ transporter homologue from T. maritima in complex with divalent cations [Thermotoga maritima],2HN2_D Crystal structure of the CorA Mg2+ transporter homologue from T. maritima in complex with divalent cations [Thermotoga maritima],2HN2_E Crystal structure of the CorA Mg2+ transporter homologue from T. maritima in complex with divalent cations [Thermotoga maritima]
2IUB_A	1.44e-06	145	625	19	329	Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_B Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_C Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_D Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_E Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_F Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_G Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_H Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_I Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima],2IUB_J Crystal structure of a divalent metal ion transporter CorA at 2.9 A resolution. [Thermotoga maritima]
6SHD_A	4.78e-06	728	1037	131	387	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WZ31|CORA_THEMA	7.06e-06	145	625	7	317	Cobalt/magnesium transport protein CorA OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=corA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
597	619
884	903