CAZyme Information: OTA30517.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA30517.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		48011.53	7.6970

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000138:60008-61389(-)

Full Sequence      

MRTIGSTTVGGKRSPSIPSLIIHTSIRPSPDMERRRQRLLLAVIFLGICFLLYRSSDGYE
TLRQRTRGGSVSNAAHDVDLRGLEPANATLGFGAVVAVSRAGSPRRESLLLASNITEIDI
TIPTQPKWTDKDVKNLRAEKDSTITKGSALAWLGHLNALRWFLSTDLETVMIMEDDVDWD
IHLRTFQIPAAAAAVRKLVSEQTQPAGATKYKPQQNNYWGNSSTWDILYLGHCGDIFKPS
SWNSRVPRAMYTDPFLPPRTEMHPYTSKFLESIDVPEDRRLIHQSIFPLCTFGFALTREA
AWRLLHEVASREADGGTMAYDVRVLEACRDLGFRCWSANPELFHHMDAESEIAVANQDAP
DGEAEKAGADQSGRLKPLRVGSAPNIACGARSSNFFTQDPGTLEFLKQKVGREGKCLRDP
MEEEMRRRPV

Enzyme Prediction     

No EC number prediction in OTA30517.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	5.23e-05	105	200	13	115	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS68839.1|GT25	7.13e-106	85	423	57	388
UNI13393.1|GT25	2.55e-94	35	418	8	388
QRD04770.1|GT25	2.90e-93	33	424	4	428
CAE7032731.1|GT25	2.76e-90	85	419	48	420
CBX98773.1|GT25	5.04e-90	33	416	5	420

PDB Hits     

OTA30517.1 has no PDB hit.

Swiss-Prot Hits     

OTA30517.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999939	0.000056

TMHMM  Annotations     

Start	End
39	56