CAZyme Information: OTA29776.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA29776.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		40453.57	7.2972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000146:103061-104165(-)

Full Sequence      

MRRAVLLFLIFNLAVIAFLVHSVWTLLSLLVVTGSEDAISKAELPAPGSKMIDTRPQLIP
KIIHQTYKNATIPPVWQEAQQSCKALHSEEDGWEYKLWTDEMSADFIKKEYPWFYDTFIN
YPYPIQRADSIRYFVLSHFGGIYIDLDDGCNRALEPLLSYPAFVRRTVPTGISNDVMGSV
PRHLFFMRVIEQIADYDRNWILPYITVMGSTGPLFLSVMWRHWTNDGLNVGDDAEGGRIR
IIFPDEYNGHTWSFFTHHLGNSWHGADVQLIFWLARNWIFVTVLGFVLGITVLLLGWWVY
RRYFVRAQAGDMSPRWKAAGPLKQRLPFWKRFTGGRDQNYELVDRHEV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	158	2.6e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.05e-67	40	289	62	306	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.86e-22	73	163	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO19119.1|GT32	8.85e-174	1	347	1	340
USW51576.1|GT32	2.56e-168	1	347	1	339
SMR59472.1|GT32	6.84e-155	1	347	1	342
SMY26667.1|GT32	6.84e-155	1	347	1	342
SMQ53033.1|GT32	6.84e-155	1	347	1	342

PDB Hits     

OTA29776.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.42e-97	1	293	1	289	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	5.01e-94	1	317	1	304	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.06e-72	37	288	56	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	7.97e-72	59	338	57	330	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.14e-54	59	295	64	293	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.837512	0.162499

TMHMM  Annotations     

Start	End
5	27
278	300