CAZyme Information: OTA28787.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA28787.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		50318.93	5.6992

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000155:63621-64962(-)

Full Sequence      

MNWDTKRYADATKRYTDYFSPKPEVTVPKQIKRTFPALAAIILLLLFLSGSFSNVNSRFW
SSTDPRFPRKIWQIWKVGSLDFQIKDLEVARSWIQKNPTYRYEVLTDDNDMAYVEREYGP
DGLNRLDIVHVYKNLNLKIIKADLLRYMVMYVEGGLYTDIDVEAVRPISKFIPERYNERD
VDMVIGVEIDEPLFADHPVLGPKCQSFVQWTFMCKPRLPVMMRLIETIMAWLKQVAEEQG
VTIAAIQLDFDQVISGTGPSAFTKAILAEMSEREGRDVKWKTFSDMEESKLVGNILVNNV
EAFAAGQGHSNAGNHESRHSLIKHHYHASHWPEQHPRFNHPMYGEVERCNWDWNCVKQWD
QDTADWETLPEEEKNRRLAQKEFEDRERAERERIEREREEREQLEREQREQREKEDRARK
EQGGLVS

Enzyme Prediction     

No EC number prediction in OTA28787.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	89	174	9.6e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.78e-20	57	263	72	280	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.77e-11	91	174	9	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY25259.1|GT32	3.89e-162	17	382	14	379
SMR53774.1|GT32	3.89e-162	17	382	14	379
SMQ51614.1|GT32	3.89e-162	17	382	14	379
SMR56074.1|GT32	3.89e-162	17	382	14	379
QIW98346.1|GT32	4.34e-161	18	374	10	367

PDB Hits     

OTA28787.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.62e-26	74	309	146	372	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.55e-22	13	297	100	355	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	8.66e-22	67	304	99	349	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	7.85e-16	68	244	97	298	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.54e-06	56	172	46	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999991	0.000019

TMHMM  Annotations     

Start	End
35	57