CAZyme Information: OTA28573.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA28573.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MUNK01000158|CGC1	33756.19	4.2130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000158:32002-33012(+)

Full Sequence      

MHAITTLASLTLAATPALALNKGTLGFALGTKLPDGSCKYTNDYEKDFDAIKSNTGSTIV
RGYAASDCNAAQQILPAAKNKGFQVVLGVWPDTDESYQADKQALQQYATQYTDQVYAVTV
GSEALYRGDLTGEQLLEKIKDIKSVLPNTKIGTVDSWNKFADGTADAVIKGGVDLIMANA
FSYWQGKQVGDGAEYTYFDDIQQALGHIQELSGSLDSIEFWNGETGWPTNGGTDYGAATA
GTDLAARYYSESVCGMLDWGVNVFYFEAFDEPWKPTSTGDNGNDADETHWGAMNADRSMK
DGFKLRCSGNGGSS

Enzyme Prediction     

No EC number prediction in OTA28573.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	44	300	1.3e-37	0.9356913183279743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.68e-71	8	297	29	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.62e-44	25	300	1	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX02470.1|GH17	6.02e-154	1	307	1	303
SMR43216.1|GH17	2.13e-153	9	307	8	305
SMY20536.1|GH17	2.13e-153	9	307	8	305
SMR45377.1|GH17	3.51e-152	9	307	8	305
SMQ46852.1|GH17	3.51e-152	9	307	8	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	6.95e-32	35	305	46	294	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.12e-31	35	305	46	294	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.44e-115	9	310	8	304	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	6.15e-80	23	307	25	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	1.98e-74	23	310	20	308	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	2.80e-74	23	310	20	308	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	1.87e-72	19	308	36	319	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000307	0.999669	CS pos: 19-20. Pr: 0.9726

TMHMM  Annotations     

There is no transmembrane helices in OTA28573.1.