CAZyme Information: OTA28306.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA28306.1
• CAZy Family: GH152
• CAZyme Description: Amb_all domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5T0V4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MUNK01000162|CGC2	33476.32	6.8462

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000162:49419-50378(+)

Full Sequence      

MKFSIFALAALSPLTSWAGALSPRQSSGPVGYANLNGGTTGGAGGKTVTVSTYADLVAAV
EDEAATIVYVKGKLSGPDKIRVGSNKSILGLDSSSGLNGVGLFLRNSQNVIIRNLAISKV
RTGDAGGDAIGVQESTNVWIDHCDLSSDLTSGKDYYDGLADFSHGADWITVSNTYFHDHF
KASLVGHSDNNAGEDKGKLHITYANNYWKNINSRMPLLRFGTAHVFNSVYDGGSTAINTR
MGAQALVESNVFTNVERAILSIDSKEVGYAVSRDNILNGATDEAPRGTLTSVPYSYSVLG
SVNVVNAVVGKAGNTLKLG

Enzyme Prediction     

EC	4.2.2.2:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	70	252	9e-87	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.54e-66	70	255	2	189	Amb_all domain.
226384	PelB	3.01e-55	67	313	78	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.99e-41	78	252	28	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO17836.1|PL1_7	3.46e-120	10	319	8	319
USW52823.1|PL1_7	3.85e-119	1	318	1	318
AQA29367.1|PL1_7	1.10e-117	10	319	8	324
QKD59971.1|PL1_7	4.15e-115	1	316	1	324
QGJ00337.1|PL1_7	1.18e-114	1	316	1	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.65e-51	26	313	1	321	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.65e-33	31	297	10	334	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
3ZSC_A	2.49e-30	29	252	6	226	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
1OOC_A	3.52e-29	25	298	10	341	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1JRG_A	9.36e-29	25	298	10	341	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WIT0|PLYA_ASPFU	1.55e-104	10	317	16	320	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|A2QV36|PLYA_ASPNC	1.66e-104	12	316	21	321	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	1.66e-104	5	316	14	321	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|B0XT32|PLYA_ASPFC	2.20e-104	10	317	16	320	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1
sp|A1CYB8|PLYA_NEOFI	3.11e-104	10	317	16	320	Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000283	0.999688	CS pos: 18-19. Pr: 0.9837

TMHMM  Annotations     

There is no transmembrane helices in OTA28306.1.