CAZyme Information: OTA27877.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA27877.1
• CAZy Family: GH13
• CAZyme Description: Cutinase [Source:UniProtKB/TrEMBL;Acc:A0A1Z5T029]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MUNK01000171|CGC1	24669.23	4.4454

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000171:58764-59736(+)

Full Sequence      

MHFSPLLTGLFAAGAVAAPAKDLAVRQIGGSTSNELEDGSCKPVIFINARASTEPGNMGL
STGPALCSSLKRALGDVACQGVGGAYSAGLAQNALPGGSSQGAFDEAKRLFNLAHTKCPD
STIVASGYSQGTAVMNGAIKDLDAEVQDQIAGVVLFGYTKNAQNDGEIENFPADKVKVYC
AATDGVCGGALLVTAGHFTYTDDVSPASDFLQQKVQSAGSSSSSSSSSSSGEESSSSGSG
FGSLFG

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	40	214	1.8e-36	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	9.86e-58	40	215	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50887.1|CE5|3.1.1.74	1.22e-81	1	217	1	218
EAA62121.1|CE5|3.1.1.74	6.03e-80	1	217	1	220
QMW26781.1|CE5	8.85e-77	1	211	1	208
BAE55151.1|CE5|3.1.1.74	8.85e-77	1	211	1	208
QMW38860.1|CE5	8.85e-77	1	211	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	3.40e-76	22	211	4	192	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	3.25e-74	34	211	5	183	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	1.47e-65	26	215	8	198	Chain A, cutinase [Malbranchea cinnamomea]
3DCN_A	1.17e-62	23	215	2	200	Glomerella cingulata apo cutinase [Colletotrichum gloeosporioides],3DD5_A Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_B Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_C Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_D Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_E Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_F Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_G Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_H Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DEA_A Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides],3DEA_B Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides]
1CUY_A	1.77e-62	19	217	6	209	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AVY9|CUTI2_EMENI	2.16e-82	1	217	1	218	Cutinase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut2 PE=1 SV=2
sp|P52956|CUTI1_ASPOR	1.57e-77	1	211	1	208	Cutinase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=cutL PE=1 SV=1
sp|B8MVS3|CUTI1_ASPFN	1.57e-77	1	211	1	208	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_072700 PE=3 SV=1
sp|Q4WQV2|CUTI2_ASPFU	3.06e-75	6	215	5	212	Probable cutinase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G14120 PE=3 SV=1
sp|B0Y537|CUTI2_ASPFC	3.06e-75	6	215	5	212	Probable cutinase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_071270 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000341	0.999607	CS pos: 26-27. Pr: 0.6325

TMHMM  Annotations     

There is no transmembrane helices in OTA27877.1.