CAZyme Information: OTA27365.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA27365.1
• CAZy Family: GH128
• CAZyme Description: Bac_rhamnosid6H domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1Z5SZB8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755	MUNK01000179|CGC1	81361.41	4.7264

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000179:107368-109877(+)

Full Sequence      

MRRRTPRGSYAIKTYKYTLLSFTSLNLSHNRHFSMAPLRQTLGAAVFVASAAVAAKYDQY
ILAPSSRSLHPASVYEVNGTVSGANSLTTSSNSTDGRGSAIFRGPSAVAYDFGKNIAGLV
TLQVGDVDEDQYIGLTYTESSLWISSEGCDATADAGLDEALWFHVTGPGNYTVERQHERG
AFRYLSLIHNTTGGIEVQQVNVRFTPMPHYADDQLRDYTGYFHCDDELLNRVWYAGAYTN
QICTIDPNHGDALVHLGEINSTQSGSTGPNTWYNNMTITNGTAALTDGAKRDRLVWAGDM
AIAVPALVVSTNDLISVTNSLDSLFGLQNATTGQLPYAGVGFRQTFSATYHLYTLIGVAD
HYLYSGDMEYLQGKWEDWKFAMNYSLSTIDDSGLMNVTSSNDWLRFGMGGHNIEANAILY
NTINQGLSLAEALNDTSVMNSWTEAAAGIKSAANSLLWNETAGLYHDNETTTLMPQDGNC
WAVVANLTDSDEKNMAISQGLSARWGPYGAPAVEAKDAVSPFISGFELEAHLEAGNVTAA
LALMRLQWGYMLDYKYMTNSTFIEGYSSDGSLHYAPYTNDPRISHAHGWATGPTSTLTFY
IGGIHLLSAAGETWEISPRLGDLKEVDTGFETPLGTFASQVNASSDGAITGMRFQTPPGT
MGSVSVPGVSGTLVNANGTTVQLENGMAENVMGGIWMLMRNATGTVGGGGGNGTMGSATP
SPYTGAAAKDGASSLLWLFVWFSLLTYSEREKKDR

Enzyme Prediction     

EC	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	283	665	4e-65	0.7281746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	4.64e-05	217	468	1	224	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
215307	PLN02567	1.92e-04	416	467	331	382	alpha,alpha-trehalase
273702	oligosac_amyl	0.004	354	477	358	475	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO19954.1|GH78	0.0	48	745	12	703
SMR48306.1|GH78	0.0	40	736	2	680
SMR49452.1|GH78	0.0	40	736	2	680
SMQ48453.1|GH78	0.0	40	736	2	679
SMY22149.1|GH78	0.0	40	736	2	679

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	8.33e-20	108	635	194	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.97e-07	287	593	237	534	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

OTA27365.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999893	0.000136

TMHMM  Annotations     

There is no transmembrane helices in OTA27365.1.