CAZyme Information: OTA26130.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA26130.1
• CAZy Family: GH114
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683		77504.28	6.6266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000191:76527-78685(-)

Full Sequence      

MLPRQALHQTCPPKRAQQVKNRPDAFDTFAPLNGYPRPDIHRTASGLVWHSLNGPWDFVF
DDTDTGLSDFWYAQSRLPDQGKRTIQVPYVFQCAASGIDERGVHEVLWYQRQIQDLRSSE
AKERGDRLLLRCGAIDYHATIWLNGRYVGEHTGGHVPFDLDLSDAVALSGYIAENTLTIR
VYDSAFDVTQPRGKQYWGPKPESIFYTPSSGIWQNIWLEVVPRLRVADGSHGTILRSNDI
EKGVVDARVAVQGRRAQEKCSVEVEASFYGIPVSTSGKKDLNKSEDFVRFDLPMRLSQEA
LSKLPAALLQDVPLEDPFCWRNNTALWSPEHPALYDLTIRLYNSTNGEIIDTVQTTTGMR
SITWTHGDGTLRLNSRPYFQALFLDQGYWPTTLLTPPDPTACKRDIQLSKAVGFNGCRKH
QKVESPEFLYWADRLGFLVWGEMASAYNFSMTGCERFEAEWMAMIRRDLNHPCIVAWTPC
NESWGYPDLGGSKRQRDHLRSLVYRTKTLDPTRPVNDNCGWEHVCTDLSTFHDYADARGM
RERCGSLQATLTRGKNMFLPAIHGRDGAEDDEGSRHVRGAPVFCSEMGGVNIAVKNDDSR
QGNWGYTTASDGKDLLRRLEELLMATVSGGHVCGIVWTQTTDIEQEMNGIYTWDRKEKMP
AAQVAEVMDRVKKVYYDGLRKHW

Enzyme Prediction     

No EC number prediction in OTA26130.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	49	663	7.8e-100	0.601063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	1.18e-33	51	515	14	445	beta-D-glucuronidase; Provisional
225789	LacZ	6.93e-32	50	516	13	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	4.14e-15	141	515	141	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	1.48e-10	51	222	3	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
395572	Glyco_hydro_2	5.25e-10	238	360	13	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR54940.1|GH2	2.03e-315	35	676	15	660
SMY25002.1|GH2	4.09e-315	35	676	15	660
SMR53262.1|GH2	4.09e-315	35	676	15	660
SMQ51362.1|GH2	6.94e-309	35	676	15	660
USW54063.1|GH2	1.19e-304	35	682	8	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.78e-65	32	671	26	582	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
1BHG_A	3.25e-22	35	534	9	491	Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],1BHG_B Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],3HN3_A Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_B Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_D Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_E Human beta-glucuronidase at 1.7 A resolution [Homo sapiens]
6LEM_B	1.22e-20	52	515	13	439	Chain B, Beta-D-glucuronidase [Escherichia coli]
3K46_A	1.23e-20	52	515	17	443	Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K46_B Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K4D_A Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],3K4D_B Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],6LEM_A Chain A, Beta-D-glucuronidase [Escherichia coli]
6LEJ_B	1.23e-20	52	515	15	441	Chain B, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O97524|BGLR_FELCA	1.32e-27	35	534	29	510	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|O18835|BGLR_CANLF	2.29e-26	35	534	29	510	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|P06760|BGLR_RAT	2.13e-24	52	534	41	507	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
sp|O77695|BGLR_CHLAE	4.77e-23	35	534	26	508	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1
sp|Q4FAT7|BGLR_PIG	6.40e-23	52	515	42	479	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000003

TMHMM  Annotations     

There is no transmembrane helices in OTA26130.1.