CAZyme Information: OTA25589.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA25589.1
• CAZy Family: GH109
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		35154.94	7.9779

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000200:73801-75101(+)

Full Sequence      

MIRYPRQAVIAALALVALGSFLLLLRNNHSVYQQPGQQQLVRVLADERTPTASRIARLGF
DEILVVTAGFHDWRAQGLKAAAERTGLAVTFLQQPHWTDTQKKAFHRGDKYESWNLPGST
GCWLGHLHALRYFLSTKQATALILEDDADWDVRIKEQVVRAQDYLRKLTEPGTADLWGTE
WDVLYLGHCGDRFHYGTLEPMPPGLRAVHQSTRPVCTYGYAVTAKGAEKIINLSHDAKAI
DTRMGRACKNGTMRCFTVNPELIHHHIPAGQAPSEIQTKQDVSAQAWTPNILHSARCNLD
RGDEELVSCSRPDS

Enzyme Prediction     

No EC number prediction in OTA25589.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	97	234	8.6e-21	0.7292817679558011

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	5.89e-07	74	151	13	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	2.93e-05	97	244	45	187	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89444.1|GT25	5.99e-51	58	302	55	331
QMW30566.1|GT25	5.99e-51	58	302	55	331
QGA19766.1|GT25	5.51e-45	64	309	1	277
QMW48287.1|GT25	4.70e-41	56	297	54	334
BAE66503.1|GT25	4.70e-41	56	297	54	334

PDB Hits     

OTA25589.1 has no PDB hit.

Swiss-Prot Hits     

OTA25589.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000025

TMHMM  Annotations     

Start	End
7	25