CAZyme Information: OTA25562.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA25562.1
• CAZy Family: GH109
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
986		110942.44	6.7478

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000201:54026-57101(-)

Full Sequence      

MFLLSVLVSILLATARAANLDEQCSCGFQDPTTRQVYTDALIVYFNETEAIDDDLFLLQD
FEHKKEQGWNSVWKVGAKPDNVEINNDTYIWPHIQSLQLRTSPSTPDHVVNGGSLRSVRQ
DMQYGSFRAGMRGAAKYTGGTALSFMLRYNGSEALNMDFMNMKDWRDARVSYLVNGEWPS
EDTVTNYTVMEAAGQDPWRDYTDVRFDWNTSSVAFWVADNQTRAVTHHDRTLPLAGQPLY
LRTWSTGDDYYMEGPPGVNGTRSHVLYVRSFFNSSAMTEGQHRKLDQRCSEVSPCSMDDT
SLRGSTSFGPASLVRWKFDLHRGRIRDNAGIVAACCSSFGIFALINVFFRRTPWHALRSL
FLGERPSQSKIERIKDGDSDNGHKNSTADYSGNTTPRTQTPAPTTGGQTPRSGYQTPLPA
YETPPPWPFPNGQAYNMSMASLPRVPSPLQSSKINSEKEAARVSENDRAGEADRIEQSPK
ESRNAAEGCSPFRDANIIKDSVEPVTQAPLTATEKGKEVAVTVAPTEGKEEPATAIPDNA
AKPPPTKRIDYLAGLVAVACLGVTLHHFCQTFWPWITLGYGPSAHYPEAEKWFKIFLGSY
LLTQLWIGPFFLTATRFLSTNYLKNGKLDDIAKKELRRAPRLFVPIVIVSLLEYFLISMG
LAASLEWLPSVSWSTWPYVSAQDNFGVFMNNMIELGYLMPNAIPEVVTHYCIGVLWTVPV
QLQFTYVVLTAAVLIRDIRNPWKRFGFYTIAILSGWYARSWSACHWCGLVLSDLEATFKW
RQYLQKRPIALYAVISGAFIFAAAAPLVAIFNQEWSFPTAENSIHPDFATGRPIMQVEAV
YPDYNEPTLTILVFSIGLQILVELSTWFQKFLSLKAILWLHPHIMTIYLTHGFVMWTWGA
WCALALNDAHVPYWANLLITLITTYALLFLLATVLTPLMEFPTQALMRNIDRWTKDEPVP
RRPTVAPFKKDLVENRQGSTAPIGES

Enzyme Prediction     

No EC number prediction in OTA25562.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	95	269	5.2e-21	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.62e-13	67	249	16	189	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
224748	OafA	6.03e-13	547	968	13	382	Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains [Cell wall/membrane/envelope biogenesis].
376607	Acyl_transf_3	1.27e-12	549	932	1	329	Acyltransferase family. This family includes a range of acyltransferase enzymes. This domain is found in many as yet uncharacterized C. elegans proteins and it is approximately 300 amino acids long.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD48161.1|GH0	2.02e-180	19	983	50	1042
CDI55223.1|GH0	3.67e-74	9	941	16	1177
SJX64811.1|GH0	1.56e-71	9	936	16	1179
SAM84175.1|GH0	1.77e-69	6	936	13	1172
CDU22258.1|GH0	3.48e-68	12	936	19	1173

PDB Hits     

OTA25562.1 has no PDB hit.

Swiss-Prot Hits     

OTA25562.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999779	CS pos: 17-18. Pr: 0.9723

TMHMM  Annotations     

Start	End
330	349
555	577
592	614
642	664
713	735
789	811
847	869
876	898
913	935