CAZyme Information: OTA25553.1

Basic Information

• Species: Hortaea werneckii
• Lineage: Ascomycota; Dothideomycetes; ; Teratosphaeriaceae; Hortaea; Hortaea werneckii
• CAZyme ID: OTA25553.1
• CAZy Family: GH106
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		28104.00	6.3753

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HwerneckiiEXF-2000	15649	1157616	29	15620

• Gene Location: location=MUNK01000201:84768-85584(-)

Full Sequence      

MATTTTTTPNTHPDRVVASPKVWTSLITNLAYLPGLLTLEASLREVNSQYPLVALYTDSF
PAEGHSALDARHIPKQHVSYLLPAVEKKFDPSDSRFYDCWSKLTPFSLVQYSRVVQLDSD
MMVRRNMDELMDLPLDGPELQGQGPRVFAASHACVCNPLNKPHYPPDWIPANCAFTTQHS
TPSLAQREGADPRAGLAMPNGGLQVVIPSAEVYARIMETLASPFTSSMDFSDQSLLSDLF
PGRAFTMRFGGMRR

Enzyme Prediction     

No EC number prediction in OTA25553.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	14	243	2e-26	0.7821011673151751

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	5.09e-43	22	244	2	171	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133064	GT8_GNT1	4.62e-12	27	158	7	138	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
227884	Gnt1	5.24e-08	91	236	148	296	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	8.41e-08	9	240	3	223	galactinol synthase
132996	Glyco_transf_8	1.51e-04	28	140	8	125	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYG85441.1|GT8	3.89e-115	14	243	6	234
BCS16669.1|GT8	1.46e-114	10	243	4	236
BCS05111.1|GT8	1.46e-114	10	243	4	236
SMY20371.1|GT8	3.76e-114	10	243	6	237
SMR45206.1|GT8	3.76e-114	10	243	6	237

PDB Hits     

OTA25553.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q947G8|GOLS1_SOLLC	5.78e-10	24	240	24	210	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q4PSY4|GOLS7_ARATH	3.74e-09	8	245	2	225	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|Q5UNW1|YR707_MIMIV	9.78e-09	24	133	8	116	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|O22893|GOLS1_ARATH	7.66e-08	24	240	34	231	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1
sp|O80518|GOLS3_ARATH	1.82e-07	32	240	28	217	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999975	0.000069

TMHMM  Annotations     

There is no transmembrane helices in OTA25553.1.